close all open/close all
Pikro_00170 Pikro_00170   last last

CDS information : Pikro_00180


close this sectionLocation

Organism
StrainATCC 15439
Entry namePikromycin
Contig
Start / Stop / Direction53,694 / 56,480 / + [in whole cluster]
1,505 / 4,291 / + [in contig]
Location53694..56480 [in whole cluster]
1505..4291 [in contig]
TypeCDS
Length2,787 bp (928 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
ProductLuxR family transcriptional regulator
Product (GenBank)putative transcriptional activator PikD
Gene
Gene (GenBank)pikD
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[9770448] A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity. (Proc Natl Acad Sci U S A. , 1998)
[11344155] Characterization and analysis of the PikD regulatory factor in the pikromycin biosynthetic pathway of Streptomyces venezuelae. (J Bacteriol. , 2001)
[18245260] Enhanced heterologous production of desosaminyl macrolides and their hydroxylated derivatives by overexpression of the pikD regulatory gene in Streptomyces venezuelae. (Appl Environ Microbiol. , 2008)
[26608164] Interspecies Complementation of the LuxR Family Pathway-Specific Regulator Involved in Macrolide Biosynthesis. (J Microbiol Biotechnol. , 2016)

close this sectionSequence

selected fasta
>LuxR family transcriptional regulator [putative transcriptional activator PikD]
MNLVERDGEIAHLRAVLDASAAGDGTLLLVSGPAGSGKTELLRSLRRLAAERETPVWSVR
ALPGDRDIPLGVLCQLLRSAEQHGADTSAVRDLLDAASRRAGNLTSPADAPLRVDETHRL
HDWLLSVSRRTPFLVAVDDLTHADTASLRFLLYCAAHHDQGGIGFVMTERASQRAGYRVF
RAELLRQPHCRNMWLSGLPPSGVRQLLAHYYGPEAAERRAPAYHATTGGNPLLLRALTQD
RQASHTTLGAAGGDEPVHGDAFAQAVLDCLHRSAEGTLETARWLAVLEQSDPLLVERLTG
TTAAAVERHIQELAAIGLLDEDGTLGQPAIREAALQDLPAGERTELHRRAAEQLHRDGAD
EDTVARHLLVGGAPDAPWALPLLERGAQQALFDDRLDDAFRILEFAVRSSTDNTQLARLA
PHLVAASWRMNPHMTTRALALFDRLLSGELPPSHPVMALIRCLVWYGRLPEAADALSRLR
PSSDNDALELSLTRMWLAALCPPLLESLPATPEPERGPVPVRLAPRTTALQAQAGVFQRG
PDNASVAQAEQILQGCRLSEETYEALETALLVLVHADRLDRALFWSDALLAEAVERRSLG
WEAVFAATRAMIAIRCGDLPTARERAELALSHAAPESWGLAVGMPLSALLLACTEAGEYE
QAERVLRQPVPDAMFDSRHGMEYMHARGRYWLATGRLHAALGEFMLCGEILGSWNLDQPS
IVPWRTSAAEVYLRLGNRQKARALAEAQLALVRPGRSRTRGLTLRVLAAAVDGQQAERLH
AEAVDMLHDSGDRLEHARALAGMSRHQQAQGDNYRARMTARLAGDMAWACGAYPLAEEIV
PGRGGRRAKAVSTELELPGGPDVGLLSEAERRVAALAARGLTNRQIARRLCVTASTVEQH
LTRVYRKLNVTRRADLPISLAQDKSVTA
selected fasta
>LuxR family transcriptional regulator [putative transcriptional activator PikD]
ATGAATCTGGTGGAACGCGACGGGGAGATAGCCCATCTCAGGGCCGTTCTTGACGCATCC
GCCGCAGGTGACGGGACGCTCTTACTCGTCTCCGGACCGGCCGGCAGCGGGAAGACGGAG
CTGCTGCGGTCGCTCCGCCGGCTGGCCGCCGAGCGGGAGACCCCCGTCTGGTCGGTCCGG
GCGCTGCCGGGTGACCGCGACATCCCCCTGGGCGTCCTCTGCCAGTTACTCCGCAGCGCC
GAACAACACGGTGCCGACACCTCCGCCGTCCGCGACCTGCTGGACGCCGCCTCGCGGCGG
GCCGGAAACCTCACCTCCCCCGCCGACGCGCCGCTCCGCGTCGACGAGACACACCGCCTG
CACGACTGGCTGCTCTCCGTCTCCCGCCGCACCCCGTTCCTCGTCGCCGTCGACGACCTG
ACCCACGCCGACACCGCGTCCCTGAGGTTCCTCCTGTACTGCGCCGCCCACCACGACCAG
GGCGGCATCGGCTTCGTCATGACCGAGCGGGCCTCGCAGCGCGCCGGATACCGGGTGTTC
CGCGCCGAGCTGCTCCGCCAGCCGCACTGCCGCAACATGTGGCTCTCCGGGCTTCCCCCC
AGCGGGGTACGCCAGTTACTCGCCCACTACTACGGCCCCGAGGCCGCCGAGCGGCGGGCC
CCCGCGTACCACGCGACGACCGGCGGGAACCCGCTGCTCCTGCGGGCGCTGACCCAGGAC
CGGCAGGCCTCCCACACCACCCTCGGCGCGGCCGGCGGCGACGAGCCCGTCCACGGCGAC
GCCTTCGCCCAGGCCGTCCTCGACTGCCTGCACCGCAGCGCCGAGGGCACACTGGAGACC
GCCCGCTGGCTCGCGGTCCTCGAACAGTCCGACCCGCTCCTGGTGGAGCGGCTCACGGGA
ACGACCGCCGCCGCCGTCGAGCGCCACATCCAGGAGCTCGCCGCCATCGGCCTCCTGGAC
GAGGACGGCACCCTGGGACAGCCCGCGATCCGCGAGGCCGCCCTCCAGGACCTGCCGGCC
GGCGAGCGCACCGAACTGCACCGGCGCGCCGCGGAGCAGCTGCACCGGGACGGCGCCGAC
GAGGACACCGTGGCCCGCCACCTGCTGGTCGGCGGCGCCCCCGACGCTCCCTGGGCGCTG
CCCCTGCTCGAACGGGGCGCGCAGCAGGCCCTGTTCGACGACCGACTCGACGACGCCTTC
CGGATCCTCGAGTTCGCCGTGCGGTCGAGCACCGACAACACCCAGCTGGCCCGCCTCGCC
CCACACCTGGTCGCGGCCTCCTGGCGGATGAACCCGCACATGACGACCCGGGCCCTCGCA
CTCTTCGACCGGCTCCTGAGCGGTGAACTGCCGCCCAGCCACCCGGTCATGGCCCTGATC
CGCTGCCTCGTCTGGTACGGGCGGCTGCCCGAGGCCGCCGACGCGCTGTCCCGGCTGCGG
CCCAGCTCCGACAACGATGCCTTGGAGCTGTCGCTCACCCGGATGTGGCTCGCGGCGCTG
TGCCCGCCGCTCCTGGAGTCCCTGCCGGCCACGCCGGAGCCGGAGCGGGGTCCCGTCCCC
GTACGGCTCGCGCCGCGGACGACCGCGCTCCAGGCCCAGGCCGGCGTCTTCCAGCGGGGC
CCGGACAACGCCTCGGTCGCGCAGGCCGAACAGATCCTGCAGGGCTGCCGGCTGTCGGAG
GAGACGTACGAGGCCCTGGAGACGGCCCTCTTGGTCCTCGTCCACGCCGACCGGCTCGAC
CGGGCGCTGTTCTGGTCGGACGCCCTGCTCGCCGAGGCCGTGGAGCGGCGGTCGCTCGGC
TGGGAGGCGGTCTTCGCCGCGACCCGGGCGATGATCGCGATCCGCTGCGGCGACCTCCCG
ACGGCGCGGGAGCGGGCCGAGCTGGCGCTCTCCCACGCGGCGCCGGAGAGCTGGGGCCTC
GCCGTGGGCATGCCCCTCTCCGCGCTGCTGCTCGCCTGCACGGAGGCCGGCGAGTACGAA
CAGGCGGAGCGGGTCCTGCGGCAGCCGGTGCCGGACGCGATGTTCGACTCGCGGCACGGC
ATGGAGTACATGCACGCCCGGGGCCGCTACTGGCTGGCGACGGGCCGGCTGCACGCGGCG
CTGGGCGAGTTCATGCTCTGCGGGGAGATCCTGGGCAGCTGGAACCTCGACCAGCCCTCG
ATCGTGCCCTGGCGGACCTCCGCCGCCGAGGTGTACCTGCGGCTCGGCAACCGCCAGAAG
GCCAGGGCGCTGGCCGAGGCCCAGCTCGCCCTGGTGCGGCCCGGGCGCTCCCGCACCCGG
GGTCTCACCCTGCGGGTCCTGGCGGCGGCGGTGGACGGCCAGCAGGCGGAGCGGCTGCAC
GCCGAGGCGGTCGACATGCTGCACGACAGCGGCGACCGGCTCGAACACGCCCGCGCGCTC
GCCGGGATGAGCCGCCACCAGCAGGCCCAGGGGGACAACTACCGGGCGAGGATGACGGCG
CGGCTCGCCGGCGACATGGCGTGGGCCTGCGGCGCGTACCCGCTGGCCGAGGAGATCGTG
CCGGGCCGCGGCGGCCGCCGGGCGAAGGCGGTGAGCACGGAGCTGGAACTGCCGGGCGGC
CCGGACGTCGGCCTGCTCTCGGAGGCCGAACGCCGGGTGGCGGCCCTGGCAGCCCGAGGA
TTGACGAACCGCCAGATAGCGCGCCGGCTCTGCGTCACCGCGAGCACGGTCGAACAGCAC
CTGACGCGCGTCTACCGCAAACTGAACGTGACCCGCCGAGCAGACCTCCCGATCAGCCTC
GCCCAGGACAAGTCCGTCACGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [880-907]  PS00622
PS00622   HTH_LUXR_1
 [866-880]  7.00000734129903e-09 PR00038 [880-896]  7.00000734129903e-09 PR00038 [896-908]  7.00000734129903e-09 PR00038
PR00038   HTHLUXR
 [866-916]  5.20000000000001e-13 PF00196
PF00196   GerE
 [859-924]  PS50043
PS50043   HTH_LUXR_2
 [863-920]  1.29999924468179e-22 SM00421
SM00421   HTH_LUXR
IPR003593 AAA+ ATPase domain (Domain)
 [24-162]  1.79999951654677e-05 SM00382
SM00382   AAA
IPR011990 Tetratricopeptide-like helical (Domain)
 [523-875]  1.3e-11 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [876-916]  3.3e-18 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [844-926]  2.49999811956465e-15 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit
Pikro_00170 Pikro_00170   last last