close all open/close all
first first   Pimar_00020 Pimar_00020

CDS information : Pimar_00010


close this sectionLocation

Organism
StrainATCC 27448 (=NBRC 13367)
Entry namePimaricin
Contig
Start / Stop / Direction819 / 175 / - [in whole cluster]
819 / 175 / - [in contig]
Locationcomplement(175..819) [in whole cluster]
complement(175..819) [in contig]
TypeCDS
Length645 bp (214 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productautoinducer exporter
amino acid exporter
Product (GenBank)PimT protein
Gene
Gene (GenBank)pimT
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[19505319] PimT, an amino acid exporter controls polyene production via secretion of the quorum sensing pimaricin-inducer PI-factor in Streptomyces natalensis. (Microb Cell Fact. , 2009)

close this sectionSequence

selected fasta
>autoinducer exporter [PimT protein]
MVSTESILAFAAMSLLVIVIPGPSVLFVIGRALAHGRRTALATVVGNLIGSYVLVVAVAW
GLGALVETSAAVLMGVKLAGAVYLVYLGVQAFRHRKEMRAADMEAPAGERRGDLRTVLDG
IFVGVTNPKGIVFFAAVLPQFVDHSTGHVPLQMMVLGLVPVTIGMITDTLWGLGASAARS
WFARSDRRLSMVGGAGGFAMIGLGVTVAATGRAD
selected fasta
>autoinducer exporter [PimT protein]
ATGGTGTCCACGGAGAGCATTCTCGCGTTCGCGGCGATGTCGCTCTTGGTGATCGTGATA
CCGGGGCCGAGCGTGCTGTTCGTGATCGGCAGGGCCCTCGCGCACGGCCGCCGCACGGCA
CTCGCCACGGTCGTCGGCAACCTCATCGGCTCATACGTCCTGGTTGTCGCTGTGGCGTGG
GGACTTGGGGCGCTGGTGGAGACCTCGGCTGCGGTGCTCATGGGTGTGAAGCTGGCCGGA
GCGGTGTATCTCGTCTACCTCGGCGTGCAGGCATTCCGGCACCGCAAGGAGATGCGTGCA
GCGGACATGGAGGCACCGGCGGGCGAGCGGCGCGGCGATCTGCGCACGGTCCTGGACGGC
ATTTTCGTAGGCGTCACGAACCCGAAGGGCATCGTCTTCTTCGCGGCGGTGCTGCCGCAG
TTCGTGGACCACTCCACGGGTCATGTCCCGCTCCAGATGATGGTGTTGGGCCTGGTCCCG
GTCACCATCGGCATGATCACCGACACTCTGTGGGGCCTGGGCGCCTCGGCGGCCCGGTCC
TGGTTCGCCCGCTCGGACCGCCGCCTTTCGATGGTCGGCGGGGCGGGCGGCTTCGCGATG
ATCGGGCTGGGCGTGACGGTCGCGGCGACGGGCCGCGCCGACTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001123 Lysine-type exporter protein (LYSE/YGGA) (Family)
 [16-208]  1.6e-28 PF01810
PF01810   LysE
SignalP
 [1-34]  0.782 Signal
Bacteria, Gram-negative   
 [1-34]  0.878 Signal
Bacteria, Gram-positive   
 [1-21]  0.68 Signal
Eukaryota   
TMHMM
 [10-32]  Transmembrane (o-i) [44-66]  Transmembrane (i-o) [70-89]  Transmembrane (o-i) [117-139]  Transmembrane (i-o) [154-176]  Transmembrane (o-i) [189-211]  Transmembrane (i-o)
Transmembrane 6   
first first   Pimar_00020 Pimar_00020