close all open/close all

CDS information : Pimar_00020


close this sectionLocation

Organism
StrainATCC 27448 (=NBRC 13367)
Entry namePimaricin
Contig
Start / Stop / Direction4,305 / 3,727 / - [in whole cluster]
1,644 / 1,066 / - [in contig]
Locationcomplement(3727..4305) [in whole cluster]
complement(1066..1644) [in contig]
TypeCDS
Length579 bp (192 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
ProductLuxR family transcriptional activator
Product (GenBank)PimM protein
Gene
Gene (GenBank)pimM
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17768260] PimM, a PAS domain positive regulator of pimaricin biosynthesis in Streptomyces natalensis. (Microbiology. , 2007)
[21187288] Molecular control of polyene macrolide biosynthesis: direct binding of the regulator PimM to eight promoters of pimaricin genes and identification of binding boxes. (J Biol Chem. , 2011)
[22693644] Hierarchical Control on Polyene Macrolide Biosynthesis: PimR Modulates Pimaricin Production via the PAS-LuxR Transcriptional Activator PimM. (PLoS One. , 2012)

close this sectionSequence

selected fasta
>LuxR family transcriptional activator [PimM protein]
MASLDRTLTIQQANQEFFRQFNGSSEDICGRNFRDVVHPSVQQPLVRQFSNLLEGKHQRF
VTPVIAVGPGEESAFTVPLTAVAVRGGLPDTTAILVMMPSAGDAEGTRVVTKRKKILSAM
DARILEGIAAGVSTVPLAARLYLSRQGVEYHVTCLLRKLKVPNRAALVSRAYSMGVLKVG
IWPPEVVDDFVK
selected fasta
>LuxR family transcriptional activator [PimM protein]
ATGGCGAGCCTTGATAGAACATTGACCATCCAGCAGGCGAACCAGGAGTTCTTCCGGCAG
TTCAACGGCTCGTCCGAGGACATATGCGGCCGCAATTTCCGTGACGTGGTGCACCCGAGC
GTGCAGCAGCCGCTGGTGCGCCAATTCTCCAATTTACTGGAAGGTAAGCACCAGCGATTC
GTCACGCCCGTCATCGCCGTGGGGCCCGGCGAGGAGTCCGCCTTCACCGTTCCCCTCACC
GCGGTCGCGGTACGCGGTGGCCTGCCCGACACGACCGCGATCCTGGTCATGATGCCCTCG
GCCGGGGACGCCGAGGGGACGCGCGTGGTGACCAAACGCAAGAAGATCCTCTCCGCGATG
GACGCGCGCATCCTCGAAGGCATCGCCGCCGGCGTCTCCACCGTCCCCTTGGCGGCACGG
CTCTACCTCAGCCGGCAGGGCGTCGAGTACCACGTGACCTGCCTGCTGCGGAAGCTGAAG
GTACCCAACCGCGCCGCGCTGGTCTCCCGTGCCTACTCCATGGGCGTGCTCAAGGTCGGC
ATCTGGCCGCCCGAGGTCGTGGACGACTTCGTGAAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000014 PAS domain (Domain)
 [1-56]  PS50112
PS50112   PAS
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [116-170]  4.7e-08 PF00196
PF00196   GerE
 [110-175]  PS50043
PS50043   HTH_LUXR_2
 [114-171]  2.90000036269908e-08 SM00421
SM00421   HTH_LUXR
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [102-178]  6.40000000000001e-12 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR013656 PAS fold-4 (Domain)
 [3-87]  2e-06 PF08448
PF08448   PAS_4
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [95-181]  3.0999994589937e-11 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit