close all open/close all

CDS information : Pimar_00030


close this sectionLocation

Organism
StrainATCC 27448 (=NBRC 13367)
Entry namePimaricin
Contig
Start / Stop / Direction4,702 / 6,744 / + [in whole cluster]
2,041 / 4,083 / + [in contig]
Location4702..6744 [in whole cluster]
2041..4083 [in contig]
TypeCDS
Length2,043 bp (680 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Producttranscriptional activator(fragment)
Product (GenBank)PimR protein
Gene
Gene (GenBank)pimR
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
Related Reference
ACC
Q70DY8
PmId
[15090496] Identification of PimR as a positive regulator of pimaricin biosynthesis in Streptomyces natalensis. (J Bacteriol. , 2004)
[22693644] Hierarchical Control on Polyene Macrolide Biosynthesis: PimR Modulates Pimaricin Production via the PAS-LuxR Transcriptional Activator PimM. (PLoS One. , 2012)

close this sectionSequence

selected fasta
>transcriptional activator(fragment) [PimR protein]
MPAPPTANVSPATTGQAELLLSVLGPMSARYNGQDLPLGPPRRRTLLALLLIRLGRVVPT
ELLVEELWGDEPPRHAVATLQSHVSHLRRALHTVTEMGQLSVLRHRTPGYVLHLDPEQVD
ACRFERLVTDGRRLLEQRDPRTAQARLTEALGLWHGSPYAEFDGHPPLSDERSRLEQIRL
TAVESCAEARLALGAAEEVAAALDGEARRHPTRERLVGHLMTALSQLGRQAEALEVYERT
RSHLVEEFGVDTAAELRRVRTAILRQEPGASAPSKKLPPTPVESTRASYVPLVRNETGDD
GVADSAESAGFEGSGEGRTAVTPQGRGRAVATDDGNGTDGSTAAVEREGITGTDARPESR
TDVPPGARADAAGTPAGTAAWRPIPGPIPGPEHAPSAAPGAGETPEFESGWTAAPSPFIG
RGPDLDRLTTAAASAVVGHGHVAGVLGPPGVGKTRLLLELAARLESMDAQENGSRLEVIW
SHCFPGDGVPPYWLWTQILRQLSATRPDAFREATEPYGALLAPLMPERSADRVEGTKWTS
DWSQARFLAHDAVCEVLLTLAGQHPLVLLLEDLQWADTASLDLLRLLSPRCQGHPLGIVL
TARKFETESDATLRRIVSDVLRGPRTATLRLCGLPRQAVGALVEAHAGSGVDPEVVEVLH
RRSEGNPYFVMQLLSLVGDAR
selected fasta
>transcriptional activator(fragment) [PimR protein]
ATGCCCGCACCACCGACCGCAAACGTGTCACCTGCAACGACCGGCCAGGCTGAGCTCTTA
CTGAGTGTTCTGGGGCCCATGTCGGCGCGATACAACGGGCAGGACCTGCCACTCGGTCCG
CCACGCCGGCGCACGCTGCTCGCCCTGCTGCTCATACGCCTCGGCCGCGTGGTGCCCACC
GAACTGCTGGTGGAGGAACTGTGGGGTGACGAACCACCCCGTCACGCCGTCGCCACACTC
CAAAGCCATGTCTCGCATCTGCGCCGCGCCCTGCATACAGTGACGGAAATGGGCCAACTT
TCGGTGCTGCGTCACCGGACGCCCGGTTATGTCCTCCATCTCGACCCCGAACAGGTCGAT
GCCTGCCGCTTCGAGCGGCTGGTCACCGACGGACGGCGGCTGCTGGAGCAGCGCGATCCG
CGCACCGCGCAGGCCCGGCTCACCGAGGCGCTGGGGCTGTGGCACGGCTCGCCCTACGCG
GAGTTCGACGGCCATCCGCCGCTCAGCGACGAGCGCTCCCGACTCGAACAGATCCGGCTC
ACCGCCGTGGAGTCCTGCGCGGAGGCCCGGCTGGCTCTCGGCGCGGCCGAAGAGGTCGCC
GCCGCTCTGGACGGGGAGGCACGCCGTCATCCCACCCGGGAGCGGCTGGTCGGCCACCTC
ATGACGGCACTGTCCCAACTCGGGCGGCAGGCCGAGGCACTTGAGGTGTACGAGCGGACG
CGTAGTCATCTGGTCGAGGAGTTCGGCGTGGACACCGCGGCGGAACTACGCCGGGTCAGA
ACCGCGATCCTGCGCCAGGAGCCGGGAGCGAGCGCCCCCTCGAAGAAGCTGCCTCCCACA
CCAGTTGAGTCCACCCGGGCGTCATATGTCCCGCTCGTGAGGAACGAGACCGGTGACGAC
GGAGTAGCGGACTCCGCGGAGTCCGCGGGCTTCGAGGGCTCCGGGGAGGGGAGGACGGCC
GTCACGCCCCAGGGGCGCGGCCGGGCGGTGGCGACCGACGACGGCAACGGGACGGACGGC
TCCACGGCGGCCGTCGAGCGCGAGGGGATCACAGGGACCGACGCGCGCCCGGAGTCGCGA
ACCGATGTGCCGCCGGGCGCGCGGGCGGACGCCGCCGGCACACCAGCAGGGACAGCCGCG
TGGCGGCCGATACCCGGGCCGATCCCCGGGCCGGAACACGCGCCGTCAGCCGCCCCGGGG
GCCGGCGAAACCCCGGAGTTCGAGTCGGGGTGGACGGCTGCCCCCTCGCCGTTCATCGGC
CGCGGCCCGGACCTCGACCGCCTGACGACCGCCGCCGCGAGCGCGGTCGTGGGCCACGGC
CATGTGGCCGGCGTCCTCGGCCCCCCAGGAGTCGGAAAGACCCGCCTGCTGCTGGAACTT
GCGGCACGGCTGGAGAGCATGGACGCGCAGGAGAACGGCTCCAGGCTGGAGGTGATCTGG
AGCCACTGCTTCCCCGGCGACGGCGTCCCCCCCTACTGGCTCTGGACCCAGATCCTGCGG
CAGCTGTCCGCCACCCGGCCGGATGCCTTTCGCGAGGCGACGGAACCGTACGGCGCCCTG
CTCGCCCCCCTGATGCCCGAGCGGTCGGCGGACCGGGTCGAAGGCACGAAATGGACCTCC
GACTGGTCCCAGGCCCGCTTCCTCGCCCACGACGCGGTCTGCGAGGTGTTGCTCACCCTC
GCCGGGCAACACCCGCTCGTGCTGCTCCTGGAAGACCTGCAATGGGCGGACACCGCCTCC
CTCGACCTGCTCAGGCTGCTGAGCCCCCGCTGCCAGGGCCATCCGCTCGGCATCGTGCTC
ACGGCCCGGAAGTTCGAAACCGAGTCGGACGCCACGCTGCGCCGGATAGTCTCCGACGTC
CTACGCGGCCCCAGGACCGCGACGCTGCGGCTCTGCGGGCTCCCCCGGCAGGCCGTCGGC
GCCCTCGTCGAGGCACATGCAGGGTCCGGTGTGGACCCGGAGGTTGTCGAGGTGCTGCAC
CGGCGCAGCGAAGGCAACCCGTACTTCGTGATGCAGCTTCTCTCCCTCGTGGGGGACGCG
CGT

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [40-112]  8.50000000000001e-14 PF00486
PF00486   Trans_reg_C
 [33-112]  3.00000067992871e-11 SM00862
SM00862   Trans_reg_C
IPR005158 Bacterial transcriptional activator domain (Domain)
 [119-264]  3.89999999999997e-41 PF03704
PF03704   BTAD
 [119-264]  1.40000506907309e-47 SM01043
SM01043   BTAD
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [29-114]  2.4e-10 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [18-113]  7.00000734129903e-15 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP
 [1-29]  0.183 Signal
Eukaryota   
 [1-31]  0.168 Signal
Bacteria, Gram-negative   
TMHMM No significant hit