close all open/close all

CDS information : Pimar_00031


close this sectionLocation

Organism
StrainATCC 27448 (=NBRC 13367)
Entry namePimaricin
Contig
Start / Stop / Direction6,746 / 8,830 / + [in whole cluster]
2 / 2,086 / + [in contig]
Location6746..8830 [in whole cluster]
2..2086 [in contig]
TypeCDS
Length2,085 bp (694 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Producttranscriptional activator(fragment)
Product (GenBank)hypothetical protein
GenepimR
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORFX
Reference
ACC
PmId
[11094342] A complex multienzyme system encoded by five polyketide synthase genes is involved in the biosynthesis of the 26-membered polyene macrolide pimaricin in Streptomyces natalensis. (Chem Biol. , 2000)
Related Reference
ACC
Q70DY8
PmId
[15090496] Identification of PimR as a positive regulator of pimaricin biosynthesis in Streptomyces natalensis. (J Bacteriol. , 2004)
[22693644] Hierarchical Control on Polyene Macrolide Biosynthesis: PimR Modulates Pimaricin Production via the PAS-LuxR Transcriptional Activator PimM. (PLoS One. , 2012)

close this sectionSequence

selected fasta
>transcriptional activator(fragment) [hypothetical protein]
TRPDAFREATEPYGALLAPLMPERSADRVEGTKWTSDWSQARFLAHDAVCEVLLTLAGQH
PLVLLLEDLQWADTASLDLLRLLSPRCQGHPLGIVLTARKFETESDATLRRIVSDVLRGP
RTATLRLCGLPRQAVGALVEAHAGSGVDPEVVEVLHRRSEGNPYFVMQLLSLVGDARRLH
RPDAVDALLAHIPTGVREALNQRFAALPEPVLRVLRLCAVIGAEVDTDLLRRTATCDASV
NAGLESAIRAGLLGEDPHHPGQLHFAHALVQETLFDELPRADRRRLHAKVADALYARRRG
HVGDEEIERVAHHSWHAKSALPAAEVLPRLLLAAEHAEQAMAYEQVEIWLRRAVHLVGFL
PPDDPATVRLEQKLHIQLGQVLATTRGYGHPEAETALTRGRALSTVTHAPEDPSVLWALC
AASLVTGRYDASRQLSGLLRDLSWQTREPVAVLGAAYGEGIVLHVRGMLPQALAELEHGV
ERADHFANEGHALARTFQHDPRVSCRSYNTFTHWLLGHRQIADARRRELLSLTEYESRPS
DRSFALYVDGVVAAWEGDTRTALASSDEGVRVAGDHGLLYWKAMLGVVKGWGLVHAGDRD
EGLALMHTSLAELGQSRTYLRHPLHLGLLGQAQHHNGQIEEARTTFRMLLAAVEQRRERV
YLHPALPATPLLHELLGHGADEALADRDPGRGQV
selected fasta
>transcriptional activator(fragment) [hypothetical protein]
ACCCGGCCGGATGCCTTTCGCGAGGCGACGGAACCGTACGGCGCCCTGCTCGCCCCCCTG
ATGCCCGAGCGGTCGGCGGACCGGGTCGAAGGCACGAAATGGACCTCCGACTGGTCCCAG
GCCCGCTTCCTCGCCCACGACGCGGTCTGCGAGGTGTTGCTCACCCTCGCCGGGCAACAC
CCGCTCGTGCTGCTCCTGGAAGACCTGCAATGGGCGGACACCGCCTCCCTCGACCTGCTC
AGGCTGCTGAGCCCCCGCTGCCAGGGCCATCCGCTCGGCATCGTGCTCACGGCCCGGAAG
TTCGAAACCGAGTCGGACGCCACGCTGCGCCGGATAGTCTCCGACGTCCTACGCGGCCCC
AGGACCGCGACGCTGCGGCTCTGCGGGCTCCCCCGGCAGGCCGTCGGCGCCCTCGTCGAG
GCACATGCAGGGTCCGGTGTGGACCCGGAGGTTGTCGAGGTGCTGCACCGGCGCAGCGAA
GGCAACCCGTACTTCGTGATGCAGCTTCTCTCCCTCGTGGGGGACGCGCGTAGACTCCAT
CGCCCGGATGCGGTTGACGCGCTCCTGGCGCACATTCCCACCGGCGTGCGCGAGGCGCTG
AACCAGCGGTTCGCCGCGCTGCCCGAACCGGTCCTGCGGGTGCTTCGACTGTGCGCCGTC
ATCGGCGCCGAGGTGGACACCGACCTGTTGCGCCGGACCGCCACCTGCGACGCATCGGTC
AACGCGGGTCTTGAGTCGGCCATCCGTGCCGGCCTGCTCGGGGAGGACCCGCACCACCCG
GGGCAGCTGCACTTCGCTCATGCCCTGGTCCAGGAGACGCTCTTCGACGAGCTTCCCCGT
GCGGATCGCCGCCGTCTGCACGCCAAGGTCGCCGACGCACTGTACGCACGCAGGCGCGGG
CACGTGGGGGACGAGGAGATCGAGCGGGTGGCACATCACAGCTGGCACGCCAAGAGTGCG
CTGCCGGCCGCCGAGGTGCTGCCCCGGCTGCTGCTCGCCGCGGAACACGCCGAGCAGGCC
ATGGCGTACGAGCAGGTGGAGATCTGGCTGCGCCGCGCAGTGCACCTGGTCGGCTTCCTG
CCCCCGGACGATCCCGCCACGGTGAGGCTGGAACAGAAACTGCACATCCAACTCGGCCAG
GTACTCGCCACCACTCGCGGCTACGGCCACCCCGAGGCCGAGACGGCATTGACGCGCGGT
CGCGCCCTCAGCACGGTCACGCATGCCCCCGAGGACCCGTCGGTGCTCTGGGCGCTGTGC
GCGGCGTCCCTGGTCACCGGCCGCTACGACGCCTCACGGCAGCTGTCCGGCCTGCTGCGG
GACCTCTCGTGGCAGACCCGGGAGCCCGTGGCGGTGCTCGGTGCGGCGTACGGCGAAGGC
ATCGTGCTGCATGTGCGCGGAATGCTGCCGCAGGCGCTCGCCGAATTGGAGCACGGCGTC
GAAAGGGCAGATCATTTCGCCAACGAGGGGCATGCGCTGGCGCGTACCTTCCAGCACGAC
CCACGCGTCTCCTGCCGCTCCTACAACACCTTCACCCACTGGCTCCTCGGACACCGGCAG
ATCGCCGACGCGCGCCGACGCGAGCTGTTGAGCCTCACCGAGTACGAGAGCAGGCCGTCC
GACCGCTCCTTCGCGCTGTACGTGGACGGGGTCGTGGCGGCTTGGGAGGGTGACACCCGC
ACCGCACTCGCCTCTAGCGACGAGGGCGTCCGTGTTGCGGGCGACCATGGGCTTCTCTAC
TGGAAGGCGATGCTGGGCGTCGTCAAAGGGTGGGGCCTGGTGCACGCAGGAGACCGCGAC
GAGGGTCTCGCCCTGATGCACACCTCGCTGGCCGAACTGGGCCAGTCCAGAACGTACTTA
CGCCACCCGCTCCATCTGGGCCTGTTGGGCCAGGCCCAACATCACAACGGGCAGATCGAG
GAGGCGAGGACGACCTTCCGGATGCTGCTGGCCGCCGTGGAACAACGCCGCGAGCGCGTG
TACCTCCACCCGGCACTGCCCGCGACTCCGCTGCTCCACGAACTGCTGGGCCACGGTGCC
GACGAGGCGCTCGCGGACCGGGACCCAGGACGGGGCCAAGTCTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011717 Tetratricopeptide TPR-4 (Repeat)
 [624-647]  0.042 PF07721
PF07721   TPR_4
IPR011990 Tetratricopeptide-like helical (Domain)
 [409-498]  6.80000000000001e-06 G3DSA:1.25.40.10 [540-652]  6.80000000000001e-06 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
SignalP No significant hit
TMHMM No significant hit