close all open/close all

CDS information : Pimar_00040


close this sectionLocation

Organism
StrainATCC 27448 (=NBRC 13367)
Entry namePimaricin
Contig
Start / Stop / Direction8,934 / 10,310 / + [in whole cluster]
2,190 / 3,566 / + [in contig]
Location8934..10310 [in whole cluster]
2190..3566 [in contig]
TypeCDS
Length1,377 bp (458 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductGDP-mycosamine glycosyltransferase
Product (GenBank)PimK protein
Gene
Gene (GenBank)pimK
EC number
Keyword
  • mycosamine
Note
Note (GenBank)
Reference
ACC
PmId
[11094342] A complex multienzyme system encoded by five polyketide synthase genes is involved in the biosynthesis of the 26-membered polyene macrolide pimaricin in Streptomyces natalensis. (Chem Biol. , 2000)
[19362642] Enzymology of the polyenes pimaricin and candicidin biosynthesis. (Methods Enzymol. , 2009)
[23324745] In vivo investigation of the substrate recognition capability and activity affecting amino acid residues of glycosyltransferase FscMI in the biosynthesis of candicidin. (Mol Biosyst. , 2013)
Related Reference
ACC
Q6W5Q9
NITE
FR008_00070
PmId
[14652074] Organizational and mutational analysis of a complete FR-008/candicidin gene cluster encoding a structurally related polyene complex. (Chem Biol. , 2003)
[23324745] In vivo investigation of the substrate recognition capability and activity affecting amino acid residues of glycosyltransferase FscMI in the biosynthesis of candicidin. (Mol Biosyst. , 2013)

close this sectionSequence

selected fasta
>GDP-mycosamine glycosyltransferase [PimK protein]
MESARRPILFVSLPESGLLNPLLVLAGELSRQGVEDLWFATDEPRRNDVKRIAEGSPVEF
ASLGEVDSEMSAVTWSDEVYREVTQPSRFKAHRAVVRHTYRPGLQAEKFRRLQAVIDEVQ
PALMVIDCISGFAVDAAIARNIPYVLSVPFLPSNVLTAHTHFAKSYTPRGFPVPHTGLSR
RMTLAQRVANELFKLRTFAMFLNPRLGKVLAEDNRRRNELGLPKASFMARIEHADLVLCN
SLAELDYPFDIPEKMRLVGAMVPPLPEAPDDQDLSRWLDAQSSVVYVGLGTITRLTREQV
GSMVEVARRLEDRHQVLWKLPSEQQHLLPPRESLPGNLRVESWVPSQMDVLAHPHVKVFF
THGGGNGFNEGMYFGKPLVVRPLWVDCYDQAVRGQDFGLSLTLDRPQTIDVNDVVDKLTR
VLGTPSFYEKAERRAALMRSAGGRETAAGLVLSLPALA
selected fasta
>GDP-mycosamine glycosyltransferase [PimK protein]
ATGGAATCCGCCCGACGGCCGATCCTCTTCGTCAGCCTTCCGGAGAGCGGCCTGCTCAAT
CCGCTGCTCGTGCTGGCGGGTGAACTCTCCCGCCAGGGCGTGGAGGACCTCTGGTTCGCC
ACCGACGAGCCGCGCCGCAACGATGTGAAACGGATCGCGGAGGGCTCCCCTGTGGAGTTC
GCCTCGCTGGGCGAAGTCGACTCCGAAATGTCGGCCGTGACGTGGAGCGACGAGGTCTAC
CGCGAGGTCACGCAGCCTTCGCGCTTCAAGGCGCACCGCGCGGTCGTCAGGCACACCTAC
CGGCCCGGCCTCCAGGCGGAGAAGTTCCGCCGTCTCCAAGCCGTCATCGACGAGGTCCAA
CCGGCGCTGATGGTCATCGACTGCATCAGCGGCTTCGCGGTCGACGCGGCCATCGCCCGG
AACATCCCGTACGTACTGAGCGTGCCGTTCCTGCCGAGCAATGTGCTGACGGCGCATACG
CACTTCGCGAAAAGCTACACCCCGCGGGGCTTCCCGGTCCCGCACACGGGTCTGTCGCGG
CGGATGACGCTCGCGCAGCGCGTCGCCAACGAGCTGTTCAAGCTGCGGACCTTCGCGATG
TTCCTCAACCCTCGGCTGGGCAAGGTCCTCGCGGAGGACAACCGGCGACGCAATGAACTC
GGGCTGCCGAAGGCCAGTTTCATGGCCAGGATCGAGCACGCCGATCTGGTGCTGTGCAAC
TCCCTCGCCGAGCTGGACTACCCCTTCGACATCCCGGAAAAGATGCGGCTGGTGGGTGCC
ATGGTGCCGCCGCTGCCCGAGGCGCCGGACGACCAGGATCTCTCGCGGTGGCTGGACGCC
CAGTCCTCCGTGGTCTACGTGGGGCTCGGGACGATCACCCGCCTGACGCGGGAGCAGGTC
GGCTCCATGGTGGAGGTGGCCCGTCGGCTGGAGGACCGGCACCAGGTGCTGTGGAAGCTG
CCCTCGGAACAGCAGCACCTGCTGCCGCCCCGGGAGTCGCTGCCGGGCAACCTCCGTGTC
GAGAGCTGGGTTCCCTCGCAGATGGACGTGCTGGCCCATCCGCATGTGAAGGTGTTCTTC
ACCCACGGCGGCGGCAACGGCTTCAACGAGGGCATGTACTTCGGCAAGCCGCTCGTGGTG
CGACCGCTGTGGGTGGACTGCTACGACCAGGCCGTCCGCGGCCAGGACTTCGGCCTCAGC
CTGACCCTCGACCGGCCGCAGACCATCGACGTCAACGACGTCGTCGACAAGCTCACGAGG
GTTCTCGGCACCCCGTCCTTCTATGAGAAGGCGGAGCGGCGGGCCGCCCTGATGCGCTCG
GCGGGCGGGCGGGAGACCGCCGCCGGCCTGGTTCTCTCGCTCCCGGCCCTGGCGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002213 UDP-glucuronosyl/UDP-glucosyltransferase (Family)
 [112-431]  8.89999999999994e-29 PF00201
PF00201   UDPGT
SignalP
 [1-26]  0.197 Signal
Bacteria, Gram-negative   
 [1-26]  0.72 Signal
Eukaryota   
TMHMM No significant hit