close all open/close all

CDS information : Pimar_00070


close this sectionLocation

Organism
StrainATCC 27448 (=NBRC 13367)
Entry namePimaricin
Contig
Start / Stop / Direction50,477 / 21,954 / - [in whole cluster]
43,733 / 15,210 / - [in contig]
Locationcomplement(21954..50477) [in whole cluster]
complement(15210..43733) [in contig]
TypeCDS
Length28,524 bp (9,507 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)PimS2 protein
Gene
Gene (GenBank)pimS2
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11094342] A complex multienzyme system encoded by five polyketide synthase genes is involved in the biosynthesis of the 26-membered polyene macrolide pimaricin in Streptomyces natalensis. (Chem Biol. , 2000)

close this sectionPKS/NRPS Module

5 malonyl-CoA
6 malonyl-CoA
7 methylmalonyl-CoA
8 malonyl-CoA
9 malonyl-CoA
10 malonyl-CoA
KS34..398
AT561..887
DH935..1097
KR1416..1596
ACP1697..1767
KS1789..2162
AT2318..2636
KR2960..3139
ACP3235..3309
KS3331..3703
AT3859..4177
KR4487..4666
ACP4767..4837
KS4858..5234
AT5393..5714
KR6025..6204
ACP6309..6379
KS6402..6773
AT6914..7219
kr7523..7701
ACP7804..7874
KS7902..8273
AT8431..8743
KR9061..9240
ACP9343..9413

close this sectionSequence

selected fasta
>polyketide synthase [PimS2 protein]
MDQEQKLRDYLKRASADLRRSRQRVGELEAAAREPIAIVGMSCRFPGGVRSPEELWSLLA
ADGDGITKSPADRGWELLAEDAGEFSGGFLHDAAEFDASFFGISPREALAMDPQQRLLLE
SSWEAFERAGIDPAAVRGTRTGMFVGAMPQEYRVGPDDDVQGFALTGTTTSVISGRLAYF
FGAVGPAVTVDTACSSSLVALHLAAHSLRQGECSLALAAGVTVMSSPTTFVEFNRQGGLS
ADGRCRSFADSADGTGWSEGVGVLVLERLSEARRNGHEILAVIRGSAVNQDGASNGLTAP
NGPSQRRVIEQALVSARLSADEVDVVEAHGTGTTLGDPVEAQALLATYGQGRDDDRPLLL
GSVKSNLGHTQAAAGMAGVIKMVLAMRHGVLPRTLHVDAPSSHVDWTQGAVRLLTEHVPW
PQGEQPRRAGVSSFGLSGTNAHTILEEAPAAPSPEAGQEDTAPVAEPLAAGAVPWLVSGR
TREALRAQAARLLEHLTSRPGLAPLDVAYSLATARSGLEHRAAFTAAGPDGARAALTALA
DGTPAPGLVQDTARTRSKLAFLFAGQGSQRPGMGRELAARFPVFATALDEVLGHFDEGLE
RPLKDVLFAAEGTPEAALLDQTGYAQPALFAIEVALYRLAESFGITPDFLAGHSIGEIAA
AHVAGVFTLADAAALVLARGRLMQALPEGGAMVSLEATEEEVLPLLEDRPDRLSIAAVNG
PAAVVIAGEADDVTAVAEHFDALGRRTKRLRVSHAFHSPLMEPMLAEFRTAVSRLTPQAP
VIPVVSGLTGTLATVEQLTSPDYWLDHARHAVRFADALRLARRARRRHLPRMGPDGVLSA
MAQSCCRGHGHRRRRRLRHARRVRPGRPEAETLTAALAGLHTRGVAVQWEPYFQGTGARR
ADLPTYAFQRRRYWPKSLPATGGDVRAAGLGAAHHPLLTAAVSVANSDGLLLTGRLSRRT
HPWLADHAVRGTVLLPGTAFLELAVRAGDEAGCGRVEELTLAAPLVLPEEGGVQVQVWVG
SPDASGRRAVSVHSRPDGPEELPWTQHAAGTLVAGEHHAGFDATVWPPADATPLDLDGFY
ARMADTGFGYGPLFQGLRAAWRSGDDVYAEVALPDSDGAASTESSAAFGLHPALLDAALH
AAAFVDLGEDARGGLPFSWQDVTLHASGASTVRVKLTPDGDDAVALAVADTTGAPVASIG
SLVLRTLPDEQIDAAHSLVRDALFELRWSEARQTAHEAPASAAVLGPDLFGLERALAPTD
LTVTAVPGPDAAPHAPDVVLAPVAGTTEDDVVTSVHARTAHVLERLRTWLTDERYAASRL
VFVTRGALATDARQASDPVAAAVWGLVRAAQSEHPGRFGLLDLDPGTTEPATEPLLRALA
LSSDEPQTAVRGTAVLTARLARAQAPQAATEWDPEGTVVLTGATGGLGRVLARHLVAERG
VRHLLLVSRRGADADGAGELMAELAAHGAQVTLAACDLADRAAVRRLLSGVPAEHPVTAV
VHSAGSLDDGVIASLTPERISAVLRPKADAVWHLHEATRDLDLAAFVVFSSLSGTVGAAG
QGNYAAANAFLDALAQLRRAQGLPGLSLAWGPWAPTAGMTGGLTDDDLDRLARMGTPALT
EEQGIALFDAATATDAAVLLPTRIDLSVLRVQSEIPPLWRGLIRTPARRSVVSASETAVT
LVQQLSRLAETDRREVVLDLVAGQVAAVLGHAGTADIDPRRPLRELGFDSLTAVELRNRL
SAATGLRTAATVIFDHPTVDALAAHLLDGLMGSEAAAAADAPRTAADDDPIVIVGMSCRY
PGGVASPEDLWRLVSEGTDAISGLPTDRGWDLDALYDPDPDRTGTSYSRFGGFLHTAADF
DPAFFGMSPREALATDSQQRLLLEASCEAVERAGIDPVSLRGSQTGVFAGVMYNDYATVL
SGGQFEGHQGSGTAPSVASGRISYTLGLEGPAVTVDTACSSSLVAMHWAMQALRAGECSL
ALAGGVTVMSTPGALIEFSRQRGLSPDGRCKAFSDGADGVGWSEGVGVLVLERLSDARRN
GHRVLAVVRGSAVNQDGASNGLTAPNGPAQQRVIRQALSAAGLSATDIDAVEGHGTGTTL
GDPIEAQALLAAYGQDREAGSPLLLGSVKSNIGHTQAAAGVAGVIKMVMAMRHGVLPRTL
HADEPSSHVEWDSGAVRLLTEETPWPQADRPRRAAVSSFGFSGTNAHLIVEEPAAVAERR
EEPALTPAVVPWTLSGKSRAALRDQAARLRSFLEERPALDPADVALSLATTRSAFDQRAV
VTGDRDELLRALADLAADRPGPALTEGEVGGAGKLAVVFSGQGSQRPGAGRELAARFPVF
AQALDEVTAALDPHLDRPLKDILFAPEGSPEAALLDRTEWTQPALFAIGVALHRLLGTWG
IRPDVLLGHSIGEITAAHVAGVLSLPDAARLVIARGRLMQALPAGGAMISLEATEDETAP
LLAGRDHEVSLAAVNGPRSVVVAGELAAAEEIAAHFADRGRKTKRLTVSHAFHSPLMEPA
LDGLREAAAELTYHAPDVTVISGLTGRPATEAELRSADYWVAHARGAVRFADTLRAAHDC
GAGTFLELGPDSVLSAAAQDALGDDAEAHIVPLLRHGRGEERCAATALARLHVRGTTADW
PGYLAGTGARTIDLPTYAFQHERYWPEQAPARLAQGAADPADAELWGAVERGDATELAAL
LGLRDEQHASLYALLPALSSWRQHRQEKALLDSTRYRVAWRPVQATAAPVLDGTWLLVTA
DGIDSDEILDALRGHGAQFETLVLDDACRDRAHLAGRLAAVRDQDRPLTGVLSLLPLADR
SGAEAGAEAGAETGAQPSTGLALSLVLIQALADTGLAAPLWTLTRGAVTTGADDPLTHPL
QAAVWGLGRVAALEHPQLWSGLIDLPAALDAPATQHLVSALAAEGGEDQIAVRATGAFGR
RLVRHPQAELPPADAFTARGTVLITGGTGALGAEAARWLARSGAEHLLLTSRRGPEAPGA
AELAAEIEELGARVTLAACDTADRAALAALLDSLPDEHPLTGVVHAAGVGQAAALADTPL
ADAAQAMAAKLLGAAHLDSLLDGHDLDFFVLVSSIAGVWGSAGQSAYSAANAYLDALAEH
RAARGLPATSVAWGPWAEAGMATHEAVTDELHKRGLRFLAPATALAELRRAVVHRDVTVT
VADIDWERYHPVFTSTRPSALFDELAEVQALIRPEDESAAPEFAARLRGLDQDGQERLLG
DLVRAEAAIALGHDSADAIAERRAFRDAGFDSLTAVELRKRLAALTGLALPATLVFDYPT
PVALARHLREQLLGTAQESAAPVAVPSGGFDEPIAIVGMSCRFPGGVRSPRQLWDLVSEG
VDAISDFPVNRGWNTGLFHPDPDNPGTTYSTQGGFLHDAGEFDASFFGISPREALSMDPQ
QRLLLETTWEAFEHAGIDPTTVHGTTTGTFIGSTYQEYGLGVEDGSAGHLVTGTSPSVLS
GRLAYLFGLEGPAVTVDTACSSSLVALHLACQSLRNGESSLALAGGATVMTNPNPFVAFS
RQRALAGDGRCKAFSEGADGMTLAEGVGVLVLERLSDAQRNGHEILAVVRGSAINQDGAS
NGLSAPNGPSQQRVIRQALANSGLTPADIDAVEAHGTGTALGDPIEAQALLATYGPGRDP
DSPLLLGSVKSNIGHTQSAAGVAGVIKMVLALRNGQLPRTLHADTPSSHIDWTPGTVSLL
TEPTDWPEGERPRRCAVSSFGISGTNAHTLLEEAPRPHEATPAGPVPPAGDAIPWVLSAR
TPGALRAQAAQLAAHLDGEAPDALDVGHTLVAARTLFDHRAVVVGTDDASRRAALDALAT
GGSAPGIVQGTADTDGRTVFVFPGQGSQWAGMGARLLEESPVFAARLTECATALSEFVDW
SLLDVLRQADGAPTLDRVDVVQPASFAVMVSLAALWTSHGITPDAVVGHSQGEIAAAAVA
GALSLEDAARVVALRSQAIARGLAGTGGMLSVPLPAADVEQRLAAYEDLSIAAVNGPRST
VVSGATAPLDALQAELVGEDIRARRIAVDYASHSAQVERVRDELRTVLEPVRPRPAQVPF
FSTVTGDWLDTTVMDAEYWFTNLRRTVHFQPAIGELLAQGHHFFIEVSSHPVLSMGIQAT
AEEAGAAAAVLGTLRRDTGATDRFLASLAEAFVRGADADWSAVFAGTGARRVPLPTYAFQ
REHLWAIPERSPDRPEADPADAEFWTAVEEEDVEALASRLRLDRTSLAPVLPALSHWRKR
RRELSTVDSWRYRATWKPLTGLPAAALTGTWLVVAPEGADTDTLTGVLAAHGAGTRTLVL
DDSCADRATLTARLTGLDGAADLTGVVSLPAPADEASATHPTLSRAVTLTVALVQALGDA
GIDAPLWCLTQGAVSTGRADRLTRPDQAQILGLGWTAALEHPQRCGAGLVDLPEELDRRA
GERLAAVLTGRSGEDQLAVRSSGVFARRVVRAAPADPAPARPWTPRGTTLVTGGTGTLAP
HLARWLAQQGAEHIVLTSRRGPAAPGAAELVQELAELGCQAEAVACDLTDRDAVAQMLAA
LRAEGRTVRTVVHTAVTIELAPLDETTLDDFAKVMDAKVIGARHLDELLGDDLDAFVLYS
STAGMWGSGAHAAYVAGNAYLNALAEHRRARGARATAVSWGIWADDLKLGRVDPGQIRRS
GLVFMDPQLALTGLRQALDDEETHLAVADVDWGRYYPVFTAARPTRLFEDLPEVRQLAQE
SAEVTDSGSEFATRLDGLAAVEQDRLLLDLVRTEAATALGHASPDVLSEQRAFRDVGFDS
LTAVDLRNRIASVTGLALPSTMVFDYPNPLALVAFLRESLAGSATGTAATTTHTAAADEP
IAIIGMSCRYPGGVGSPEDLWRLVTEGGDATGEFPADRGWDAEGLYDPDPDRAGHTYSTR
GGFLHDAADFDASFFGISPREALAMDPQQRLLLETSWEAMERAGIDPATLRGSSTGTFIG
ASYQDYRAFGAGPDGAEGHLITGTISSVLSGRLSYTYGFEGPAVSLDTACSSSLVALHLA
CQSLRNGESSLALAGGVSIMSTPGAFVGFSRQRAMAADGRCKAYSDQADGMSLAEGVGLV
LVERLSDARRNGHQVLAVIRGSAVNQDGASNGLTAPNGPSQQRVIRQALANAEVDPDGID
VIDGHGTGTALGDPIEAQALLATYGQGRDPEHPLLLGSVKSNIGHTQMASGVASVIKMVM
AMRHAAVPRSLHIDRPSSHVDWSSGAIQLLTEPLPWPATGHPRRAGVSSFGLSGTNVHTI
LEQAPEDRTEEDTDTAPARPADPTPVPVTLSGRTEAGLRAQAGRLLTHLADHPELPLTDL
AFSLATSRAALEHRAAVVTDDPDTLTRALTALRDATPDGGLLTGRPDRGRLAFLFTGQGS
QRPGMGRELYDRHPVYAEALDAVLARFDLELDRPLREILFADPGTPEAELLDDTGYTQPA
LFALEVALFRLAESWGLRPDYVAGHSIGELAAAHAAGVLSLEDACTLVAARGRLMAALPS
GGAMASVEATEDEAAAVLAPYEGRAAVAAVNTPTSLVVSGDEDAVHAVAAHFHELGRRTK
QLRVSHAFHSPHMDAMLDDFTRAAEGITFHAPELPLVSTLTGELILADDLCSAPYWTRQV
RGTVRFADAVRHLTEHGVTTFFELGPDAVLSGAVRESTGEQTPATAVPALRRDRPEAPAL
TTALARLHLHGVRVDWDAVFAGGGARRIDLPTYPFQRERYWPEAAAGAAAPAHPADAADA
EFWSAVERADLPSLGSSLDLDDDTLTAVVPALSSWRRKSRERSTVDGWRYRTTWKPLTGT
ATAGHPAGTWLVLAPADGDRAWTDAVAGALGADAVRVEVSTAQRQELAERLSELAAEHGE
FAGVLSLLATAGEGAEDADDATTEGLLLTATALQALGDAGIDAPLWCVTRTAVAVDRAEH
PARPAQAAVWGLGRVAALEHPQRWGGLVDLPDELDGATLRRLAAVLADSGDEDQLAVRTT
ATFVRRLAHHRAAPAPEAATFRPTGTVLVTGGTGALGGHVARWLAEAGAEHLLLVSRRGT
DAPGAGELAAEIAELGARVTVAACDTADRDALAAVLAAIPDEHPLTAVFHTAGTVDDGTL
DTLTPEQFASVLRTKVTATRNLHETTREQDLSAFVLFSSVAGTLGAPGQGNYAAGNAFLD
AFAAHRRAHGLPATSLAWGPWAETGMAADGTGIQDRVRRGGFTPMPPRLALTALRRAIEH
DATALTLADIDWQRYAEVFTATRPSLFVADLPELQQVTPPAGTPEAALREPALRQRLAGL
SPAARPRFVLDLVRTQVAAVLGHSGTSAIGAERAFSDLGFDSLTTVELRNTLTATTGLKL
PATLVYDYPTPTALADFLLAELLGALPESGAPAFVGRAADDDPIVIVGMNCRFPGGIRSP
EDLWQLLSSGEDAISGFPADRGWDLDALARGASATLEGGFLDGVGLFDAPFFGISPREAL
AMDPQQRLLLETSWEAFERAGIDATTLRGSRTGVFVGTNGQDYATLLRQGTGTTDIRGHV
ATGNTASVMSGRLSYAFGLEGPAVTVDTACSSALVALHMAAGALRSGECTLALAGGVSVM
SSPDSFTEFTVQGGLAPDGRCKPFADAADGTSWSEGVGVLLLERLSDARRNGHDVWGIVR
GTAVNQDGASNGLTAPSGRAQQRAIRQALADADLAPADVDVVEAHGTGTTLGDPIEAHAL
IAAYGQDRPTDRPLLLGAVKSNLGHTQAAAGVAGTIKVLLAMRHGVLPKTLHTDSPSAHV
DWTAGTVSLLTEQQEWPETGHARRAGVSAFGVSGTNAHVIIEQAPDAEESVAPEPTTVPG
LVPWPVSGKSEAALEAGIERVSALTGRSPVDVGHSLTTGRAAFTHRAVLAADGAGVRELA
RGVAHEADGKLAVLFSGQGAQRVGMGRELYVRFPVFAEALDGVLAHFDAGLRDVMFGDAE
GLDETGFTQPALFAIEVALFRLAESLGVRPDFVGGHSIGEIAAAHVAGVFSLADACALVA
ARARLMQALPAGGAMVAVQATAEEAAARLVDGVSIAAVNGPEAVVIAGEQREVLRIAKEF
TGLGRKTRRLPVSHAFHSPLMEPMLEDFRRVAEGLSYEAPRIALVSNLTGELATEDLVRS
AEYWVRHVRETVRFADGVSALAAEGASVFLELGPDGVLTAMAQHTLDGTATAVPALRKDW
SEETALLTALAQLHVVGVGVDWSGIFAGTGARRVDLPTYPFQHQWYWPDGAPAAEATTGA
QDPVDAEFWDAVERADLSSLSDSLELDDAALSALVPALSAWRRKRVERSTVDGWRYHVTF
KPLTGTAPGTLAGTWLALVPTGAADDEWTTAVLAALGDAVVIAEVDPADRGAFAGRLGEL
AERGTEFTGVVSSSQSRTPSPSPSDRPGPTRRWRALAEAGIDAPLWCVTRDAVPVDRSES
EVSPAQAAVWGLGRVAALDHPDRWGGLVDVPQEHDRRTAERLRAVLSGAGDEDQVALRPS
GAFGRRLVRATDDTPATPWQPAGTVLVVGPASGTGGHCARWLAGQGAQHLVLADRTAPDT
AQLIGELDALGVPLTVLDCAPADGEALLSALAALPEPLTAVIYADGPSDADAYGTATTAD
PGASLAALYADVESLAAVAEAATGARPLGAFVLFSSIAGTWGAGGRGTEAAAGAQLDALA
GMLRARGLPATAVSWGGWADATSGSLAAHLRANGLPPMDPARALTALARSLGTDTPSVTV
ADVRWDEFAPAFTRRRHSALFAELPEAREALAESDGSAPGTADAASGLRAELAARPDAER
TEHLLALVRDRVAAVLGFADADAVPSGQAFTDLGFDSLTAVDLRNQLAVATGLALPATLV
FDYPTADALAGYLRAELLGEGGKDAEELPAVVRTKDADTAEDPVVIVGMSCRYPGGIRSP
EDLWQLVMGEADAIGGFPTDRGWDLDRLLHGDRDGRGRTVTGQGGFLYDVADFDPGFFGI
APREAMVMDPQQRILLEATWEALERTGIDPARLRGGDTGVFIGGGSGDYRPEAGQLGHAQ
TAQSASLLSGRVAYHFGLEGPSVSVDTACSSSLVALHLAAQALRNGECSIALTGGVTVMS
SPVNFVEFGEMGALAPDGRCRPFASAAGGTGWSEGVGVLVLERLSDARRNGHEVLAVLRG
SAVNQDGASNGITAPNGPSQRRVIQRALANAGLAPADVDAVEAHGTGTTLGDPIEAQALL
ATYGQGRDPELPLLLGSVKSNIGHTQAAAGIAGVIKMVLAMRHGMLPRSLHIDEPSAHVD
WSAGAVELLAQAADWPRTGRPRRAGISAFGASGTNSHVIIEQPAPTVAEEPERPQEAGGP
LPVPVSGAVPDALRAQARQLHAYVAGRPGLTVAEFALSTATTRSAFTHRAAVLAEDREEL
LAGLAALAGGLDTPQVLRGRVAERRGRLAVLFSGQGSQRVGMGRELHARFPVFAEALDEV
TARLEAELELPLREVMFGDSERLNETGYTQPALFAIEVALFRLVASWGIRPDFVAGHSIG
EIAAAHVAGVFSLDDACRLVAARARLMNALPAGGAMVAVQATEEETRACLTDGVSIAAVN
GPRSVVLSGDEAAVLDLAEKFTADGRKTRRLRVSHAFHSLHMDAVLDDFRRVAQSVGYDA
PTIPLVSNVTGEAATERQVCSPDYWVRHVREAVRFGDGVRTLADRGVTAFLELGPDGALC
AMAQETLDTLPSPAVTVPALRRDRGEQECVVTALARLHVDGVSPHWPAVLTGPRTAPRRT
DLPTYPFQHQRFWPAAQPATDPTPATAADDGFWSAVREADFADLATTLDVERDALSTVLP
ALADWRRRREESGTVDGWRQQITFEPLTRTPSHTPAGTRLAVIPAGHEQDPLVADVVAAL
GPDTVRLTAPGSDRAALADLLRQQAADGTEFTAVVSLLALATEPAHSEPAHSEPAHPAHA
PEALALTTTLIQALGDADLAAPLWCVTRGAVAAAPGEPVSGPAQAAVWGLGRVAALEYPQ
RWGGLIDLPAALDDRTAARLADVLAAPGGEDQIAIRPSAVLGRRLVPVPAGRTTREWNPT
GTVLITGGTGALGARVARELARAGAEHLLLLSRRGPDAPGADALRAELTALGADVTLTAC
DAADRDALAKVLADIPETSPLTGVVHTAGVIDDGVLDSLTPDRFEDVFRAKAASALALHD
LTEDLDLAVFALFSSSSGAVGNAGQANYAAANAFLDALAERRRAQGLAATSLAWGVWGGG
GMAADQRAADVARRTGIRPLDPDLAVVALRRAVMDGRPTEVVADIERDLFVRSFTAVRPS
PLLGAPTVDAEHRAAGDTGEDTTGDALRAKLTGLPPAKRSEAVRDLVRTRAAAVLGHPTA
DAVGADRAFRDLGFDSLSAVELRNQLGAATGLNLTATLVFDHPNPAALADHLLSLLVPDE
DPGEGTADDGDPDSSAIRALLASVSVAQLREIGVLEPLLKLAAEQTAASGAEAAAATAAD
AYDESIDAMDIADLVQAAFDGNSPQER
selected fasta
>polyketide synthase [PimS2 protein]
ATGGACCAGGAACAGAAGCTCCGCGACTACCTAAAGCGGGCAAGTGCCGATCTGCGGCGC
TCCCGGCAGCGGGTGGGCGAGCTGGAGGCGGCGGCCCGCGAGCCGATCGCGATCGTGGGC
ATGAGCTGCCGCTTCCCGGGCGGCGTGCGCAGTCCCGAGGAGCTCTGGTCCCTGCTCGCC
GCCGACGGGGACGGCATCACCAAGTCCCCCGCCGACCGCGGCTGGGAGCTCCTGGCCGAG
GACGCGGGGGAATTCTCCGGCGGATTCCTGCACGACGCGGCCGAGTTCGACGCCTCCTTC
TTCGGGATCTCGCCCCGTGAGGCGCTCGCCATGGACCCGCAGCAGCGACTGCTGCTGGAG
TCCTCCTGGGAAGCCTTCGAGCGGGCCGGCATCGACCCGGCGGCGGTCCGGGGCACCAGG
ACGGGCATGTTCGTCGGGGCGATGCCCCAGGAATACCGGGTGGGCCCGGACGACGACGTC
CAGGGCTTCGCCCTGACGGGCACCACCACCAGCGTCATCTCGGGCCGACTCGCCTACTTC
TTCGGCGCCGTGGGCCCGGCGGTCACCGTCGACACCGCCTGCTCGTCCTCGCTCGTGGCC
CTGCACCTGGCCGCCCACTCCCTGCGCCAGGGCGAGTGCTCCCTGGCGCTTGCCGCCGGC
GTCACCGTGATGTCCAGCCCCACCACCTTCGTGGAGTTCAACCGCCAGGGCGGGCTCTCC
GCCGACGGGCGCTGCCGCTCCTTCGCCGACTCCGCCGACGGCACCGGCTGGTCCGAGGGC
GTCGGCGTCCTGGTCCTGGAACGCCTCTCGGAGGCCCGTCGCAACGGGCACGAGATCCTG
GCCGTGATCCGCGGCTCCGCCGTCAACCAGGACGGCGCCTCCAACGGGCTGACCGCACCC
AACGGCCCCTCGCAGCGACGGGTGATCGAGCAGGCGCTGGTCAGCGCGCGGCTCTCGGCC
GATGAGGTCGACGTCGTCGAGGCACACGGCACCGGCACCACCCTGGGCGACCCGGTCGAG
GCCCAGGCGCTGCTGGCGACCTACGGCCAGGGCCGCGACGACGACCGCCCGCTGCTGCTG
GGGTCCGTCAAATCGAACCTCGGCCACACCCAGGCGGCGGCCGGTATGGCCGGCGTCATC
AAGATGGTGCTGGCGATGCGGCACGGCGTGCTCCCGCGCACGCTCCATGTGGACGCGCCG
TCCTCGCACGTCGACTGGACGCAGGGGGCCGTACGCCTGCTCACCGAGCACGTTCCGTGG
CCGCAGGGCGAACAGCCGCGCCGGGCCGGTGTTTCGTCGTTCGGGCTCAGCGGCACCAAT
GCGCACACCATTCTGGAGGAGGCCCCGGCCGCCCCGTCGCCCGAGGCGGGCCAGGAAGAC
ACCGCGCCGGTCGCGGAACCTCTGGCGGCGGGCGCCGTCCCGTGGCTCGTCTCCGGCCGC
ACCCGCGAGGCGCTTCGTGCCCAGGCGGCGCGACTGCTCGAACACCTCACCTCCCGCCCC
GGCCTCGCGCCCCTGGACGTGGCCTACTCCCTGGCCACGGCCCGCTCCGGCCTGGAGCAC
CGCGCCGCGTTCACCGCGGCCGGCCCGGACGGCGCCCGCGCCGCCCTCACCGCGCTCGCC
GACGGCACACCGGCCCCGGGTCTGGTGCAGGACACCGCCCGTACCCGGTCCAAGCTCGCC
TTCCTCTTCGCGGGCCAGGGCTCCCAGCGGCCGGGCATGGGGCGTGAACTGGCCGCCCGC
TTCCCCGTCTTCGCCACCGCCCTCGACGAGGTCCTCGGCCACTTCGACGAGGGTCTTGAA
CGGCCCCTGAAGGACGTCCTGTTCGCCGCCGAGGGCACGCCCGAGGCCGCCCTGCTGGAC
CAGACCGGCTATGCCCAGCCCGCGCTGTTCGCGATCGAGGTCGCGCTGTACCGGCTCGCC
GAGTCCTTCGGCATCACGCCGGACTTCCTCGCCGGGCACTCCATCGGCGAAATCGCCGCG
GCGCACGTCGCCGGCGTCTTCACCCTGGCCGACGCCGCGGCCTTGGTGCTCGCCCGCGGC
CGCCTCATGCAGGCGCTGCCCGAAGGCGGCGCCATGGTCTCCCTCGAAGCCACCGAGGAA
GAGGTCCTGCCCCTCCTGGAGGACCGGCCCGACCGCCTCTCGATCGCCGCGGTCAACGGG
CCCGCCGCCGTCGTAATCGCCGGTGAGGCCGACGACGTCACCGCCGTCGCCGAGCACTTC
GACGCGCTGGGCCGCAGGACCAAGCGGCTGCGTGTCTCGCACGCGTTCCACTCCCCGCTC
ATGGAACCCATGCTGGCGGAGTTCCGCACGGCCGTCTCCCGGCTCACCCCGCAGGCACCC
GTGATCCCGGTCGTCTCCGGCCTGACGGGCACCCTCGCCACGGTGGAGCAGCTGACCTCC
CCCGACTACTGGTTGGACCACGCCCGCCACGCCGTACGGTTCGCCGACGCCCTCCGCCTG
GCTCGACGGGCACGGCGCCGCCACCTTCCTCGAATGGGCCCCGACGGCGTCCTGTCCGCC
ATGGCCCAGTCCTGCTGCCGCGGACACGGACACCGCCGCCGACGGCGTCTCCGCCACGCT
CGCCGTGTGCGCCCCGGCCGCCCCGAGGCCGAGACGCTCACCGCCGCGCTGGCGGGTCTG
CACACCCGCGGCGTGGCCGTCCAGTGGGAGCCCTACTTCCAGGGCACCGGCGCCCGCCGC
GCCGACCTGCCCACGTACGCCTTCCAGCGCCGCCGCTACTGGCCCAAGAGCCTGCCCGCG
ACGGGCGGTGACGTGCGTGCCGCCGGTCTGGGCGCGGCACACCACCCGTTGCTGACGGCG
GCCGTGTCGGTCGCCAACTCCGACGGGCTCCTGCTGACCGGACGGCTGTCGCGGCGTACC
CACCCCTGGCTCGCCGACCACGCCGTGCGCGGCACGGTGCTGCTGCCGGGCACCGCCTTC
CTGGAGCTGGCCGTACGCGCCGGGGACGAGGCCGGCTGCGGCCGCGTGGAGGAACTCACC
CTCGCCGCCCCGCTGGTGCTGCCCGAGGAGGGCGGCGTCCAGGTGCAGGTGTGGGTGGGC
AGCCCCGACGCGTCGGGCCGCCGCGCCGTCAGCGTTCACTCCCGCCCCGACGGGCCCGAG
GAGCTGCCCTGGACCCAGCACGCCGCGGGCACCCTCGTCGCCGGTGAGCACCACGCCGGA
TTCGACGCCACCGTCTGGCCGCCCGCCGACGCGACCCCGCTGGACCTCGACGGCTTCTAC
GCCCGCATGGCCGACACCGGCTTCGGATACGGCCCCCTCTTCCAGGGCCTGCGCGCCGCC
TGGCGCAGCGGCGACGACGTCTACGCCGAGGTGGCGCTGCCCGACTCCGACGGCGCCGCG
TCCACCGAGTCGTCCGCGGCATTCGGGCTCCACCCGGCCCTGCTGGACGCCGCGCTGCAC
GCCGCGGCCTTCGTTGACCTGGGCGAGGACGCCCGCGGCGGCCTGCCCTTCTCGTGGCAG
GACGTCACCCTGCACGCGAGCGGCGCGAGCACGGTCCGGGTGAAGCTGACCCCGGACGGG
GACGATGCGGTGGCCCTCGCCGTCGCCGACACCACCGGCGCCCCCGTCGCCTCCATCGGC
TCGCTGGTCCTGCGCACCCTGCCCGACGAGCAGATCGACGCGGCCCACTCCCTCGTCCGC
GACGCCCTGTTCGAGCTGCGGTGGAGCGAGGCGCGCCAGACCGCCCACGAGGCGCCCGCC
TCGGCCGCCGTCCTCGGCCCCGACCTCTTCGGCCTGGAGCGGGCCCTTGCACCGACGGAC
CTCACGGTCACGGCGGTGCCCGGCCCGGACGCCGCCCCCCACGCCCCGGACGTGGTCCTC
GCCCCCGTCGCGGGCACGACCGAGGACGACGTCGTCACCTCCGTGCACGCCCGCACCGCC
CACGTACTGGAGCGCCTGCGGACCTGGCTGACGGACGAGCGGTACGCCGCCTCCCGGCTG
GTCTTCGTCACCCGTGGCGCCCTCGCCACCGACGCCCGGCAGGCATCCGACCCGGTGGCC
GCCGCCGTCTGGGGCCTCGTACGGGCCGCGCAGAGCGAACACCCCGGCCGCTTCGGGCTG
TTGGACCTCGACCCCGGCACCACCGAGCCCGCCACGGAGCCGCTGCTGCGGGCCCTGGCC
CTGTCCTCGGACGAGCCGCAGACCGCCGTCCGCGGCACCGCCGTGCTCACCGCGCGACTC
GCCCGCGCCCAGGCGCCGCAGGCCGCCACGGAGTGGGACCCGGAGGGCACCGTGGTGCTC
ACCGGAGCCACCGGCGGCCTGGGCCGCGTACTGGCCCGGCACCTGGTCGCCGAGCGCGGC
GTACGCCATCTGCTGCTCGTCAGCCGCCGCGGCGCCGACGCCGACGGCGCCGGGGAACTC
ATGGCCGAACTGGCCGCGCACGGCGCGCAGGTGACCCTCGCGGCATGCGACCTGGCCGAC
CGCGCCGCCGTGCGGCGGCTGCTGTCCGGTGTGCCCGCCGAGCACCCCGTCACCGCCGTC
GTGCACAGCGCCGGCAGCCTCGACGACGGCGTGATCGCCTCGCTCACCCCCGAGCGGATC
AGTGCCGTCCTGCGGCCCAAGGCCGACGCCGTCTGGCACCTCCACGAGGCCACCCGGGAC
CTGGACCTGGCCGCCTTCGTCGTCTTCTCGTCCCTCTCCGGCACCGTGGGCGCGGCGGGC
CAGGGCAACTACGCCGCCGCCAACGCCTTCCTCGATGCGCTCGCCCAACTGCGCCGTGCC
CAGGGGCTGCCGGGCCTCTCCCTGGCCTGGGGCCCGTGGGCGCCCACCGCCGGAATGACC
GGCGGCCTGACGGACGACGACCTCGATCGCCTGGCCCGGATGGGCACGCCCGCGCTCACC
GAGGAACAGGGCATCGCCCTCTTCGACGCGGCCACCGCCACGGACGCCGCCGTCCTGCTG
CCGACCCGCATCGACCTTTCCGTCCTGCGCGTCCAGAGCGAGATTCCGCCGCTGTGGCGC
GGCCTGATCCGTACCCCGGCCCGCCGCTCGGTGGTCTCCGCCTCGGAGACCGCCGTCACC
CTCGTCCAGCAGCTGTCCCGGCTGGCGGAGACCGACCGCCGCGAGGTCGTGCTCGACCTC
GTGGCCGGACAGGTGGCCGCCGTGCTCGGCCACGCCGGCACCGCCGACATCGACCCGCGG
CGCCCGCTGCGGGAGCTGGGCTTCGACTCGCTGACCGCCGTGGAACTGCGCAACCGGCTC
AGCGCGGCCACCGGCCTGCGCACCGCCGCGACGGTCATCTTCGACCACCCGACCGTCGAT
GCCCTCGCCGCGCACCTCCTCGACGGACTCATGGGCTCCGAAGCCGCCGCCGCGGCCGAC
GCGCCCCGCACCGCCGCGGACGACGACCCCATCGTCATCGTCGGCATGAGCTGCCGCTAC
CCGGGCGGCGTCGCCTCGCCCGAGGACCTGTGGCGGCTGGTCAGCGAGGGCACCGACGCC
ATCTCGGGCCTGCCCACCGACCGGGGCTGGGACCTGGACGCGCTCTACGACCCGGACCCG
GACCGCACCGGCACCTCCTACTCCCGTTTCGGCGGATTCCTGCACACCGCCGCCGACTTC
GACCCCGCCTTCTTCGGCATGAGCCCCCGCGAGGCCCTGGCCACCGACTCCCAGCAGCGC
CTCCTCCTCGAAGCGTCCTGCGAGGCCGTCGAGCGGGCGGGCATCGACCCGGTGTCCCTG
CGCGGCAGCCAGACCGGCGTGTTCGCGGGCGTGATGTACAACGACTACGCCACGGTGCTC
TCCGGCGGGCAGTTCGAGGGCCACCAGGGCAGCGGCACCGCCCCGAGCGTCGCCTCCGGG
CGCATCTCCTACACCCTCGGCCTCGAAGGCCCCGCCGTCACCGTCGACACCGCCTGCTCG
TCCTCGCTGGTCGCCATGCACTGGGCGATGCAGGCCCTGCGCGCGGGGGAGTGCTCGCTC
GCGCTGGCCGGCGGAGTCACGGTCATGTCGACGCCGGGTGCCCTCATCGAGTTCTCCCGG
CAGCGCGGCCTGTCCCCGGACGGGCGCTGCAAGGCGTTCTCCGACGGCGCCGACGGCGTC
GGCTGGTCCGAGGGCGTGGGCGTCCTCGTCCTGGAACGCCTCTCCGACGCCCGCCGCAAC
GGGCACCGGGTCCTGGCCGTCGTACGGGGCTCCGCCGTCAACCAGGACGGCGCCTCCAAC
GGCCTGACCGCCCCCAACGGCCCCGCCCAGCAGCGGGTGATCCGGCAGGCCCTGTCCGCC
GCCGGCCTGTCCGCCACGGACATCGACGCGGTGGAGGGCCACGGCACCGGCACCACCCTC
GGCGACCCCATCGAGGCGCAGGCCCTGCTCGCCGCCTACGGCCAGGACCGCGAGGCGGGG
AGTCCGCTGCTGCTGGGCTCGGTGAAGTCCAACATCGGCCACACCCAGGCCGCGGCCGGC
GTCGCCGGCGTCATCAAGATGGTCATGGCCATGCGCCACGGCGTGCTGCCCCGCACCCTG
CACGCCGACGAGCCGTCCTCACACGTGGAGTGGGACTCCGGGGCGGTGCGCCTGCTCACC
GAGGAGACACCCTGGCCGCAGGCCGACCGGCCGCGCCGCGCCGCCGTCTCCTCCTTCGGA
TTCAGCGGTACCAACGCGCACCTCATCGTCGAGGAGCCGGCGGCCGTCGCCGAGCGGCGC
GAGGAGCCGGCGCTCACCCCGGCCGTCGTGCCCTGGACGCTGTCGGGCAAGAGCCGGGCC
GCGCTGCGCGACCAGGCCGCCCGCCTGCGGTCCTTCCTGGAGGAGCGCCCCGCCCTGGAC
CCGGCCGATGTCGCGCTCTCCCTGGCCACCACCCGCTCGGCCTTCGACCAGCGCGCCGTC
GTCACCGGCGACCGCGACGAACTGCTGCGCGCCCTCGCCGACCTGGCCGCCGACCGGCCC
GGCCCCGCGCTGACCGAGGGCGAGGTCGGCGGCGCGGGCAAACTGGCCGTGGTGTTCTCC
GGGCAGGGCAGCCAGCGCCCCGGCGCCGGCCGGGAACTCGCCGCCCGCTTCCCCGTGTTC
GCCCAGGCCCTCGACGAGGTGACCGCCGCCCTCGACCCGCACCTGGACCGCCCCCTCAAG
GACATCCTGTTCGCCCCGGAGGGCAGCCCCGAGGCGGCGCTGCTGGACCGCACCGAGTGG
ACCCAGCCCGCGCTGTTCGCCATCGGGGTCGCGCTCCACCGGCTGCTCGGCACCTGGGGC
ATCCGCCCCGACGTGCTGCTGGGCCACTCCATCGGCGAGATCACCGCCGCGCATGTCGCG
GGCGTCCTCTCGCTGCCCGACGCGGCCCGCCTGGTGATCGCGCGCGGACGGCTGATGCAG
GCGCTGCCCGCCGGCGGCGCGATGATCTCCCTTGAGGCCACCGAGGACGAGACCGCGCCG
CTGCTCGCCGGGCGCGACCACGAGGTCTCCCTGGCCGCCGTCAACGGCCCCCGCAGCGTC
GTGGTCGCCGGAGAACTGGCCGCCGCCGAGGAGATCGCCGCCCACTTCGCCGACCGGGGC
CGCAAGACCAAGCGCCTGACGGTCAGCCACGCCTTCCACTCGCCGCTCATGGAACCCGCG
CTCGACGGGCTGCGCGAGGCCGCCGCCGAACTCACCTACCACGCGCCGGACGTGACCGTC
ATCTCCGGCCTGACCGGACGGCCCGCCACCGAAGCGGAACTGCGCTCGGCCGACTACTGG
GTCGCGCACGCCCGCGGCGCCGTCCGCTTCGCCGACACCCTGCGCGCCGCGCACGACTGC
GGCGCCGGCACCTTCCTCGAACTCGGCCCCGACAGCGTGCTGTCGGCCGCCGCCCAGGAC
GCCCTCGGCGACGACGCGGAGGCGCATATCGTCCCGCTGCTGCGCCACGGGCGCGGCGAG
GAGCGCTGCGCGGCCACCGCGCTGGCCCGCCTGCACGTCCGCGGCACGACCGCTGACTGG
CCCGGATACCTCGCCGGCACCGGCGCCCGCACCATCGACCTGCCCACCTACGCCTTCCAG
CACGAGCGCTACTGGCCCGAACAGGCCCCGGCCCGCCTCGCGCAGGGTGCCGCCGACCCC
GCGGACGCCGAGCTGTGGGGCGCCGTCGAACGCGGCGACGCCACGGAACTGGCCGCCCTC
CTCGGGCTGCGCGACGAACAGCACGCCTCCCTGTACGCCCTGCTGCCCGCGCTGTCCTCC
TGGCGCCAGCACCGGCAGGAGAAGGCGCTGCTGGACTCCACCCGCTACCGCGTGGCCTGG
CGCCCCGTGCAGGCAACCGCCGCACCCGTACTGGACGGCACCTGGCTGCTCGTCACCGCC
GACGGCATCGACAGCGACGAGATCCTCGACGCGCTGCGCGGCCACGGCGCCCAGTTCGAG
ACCCTCGTCCTGGACGACGCCTGCCGCGACCGCGCCCATCTCGCCGGCCGGCTCGCCGCC
GTACGCGACCAGGACCGGCCCCTGACCGGTGTGCTGTCCCTGCTGCCGCTCGCCGACCGG
TCCGGGGCCGAGGCCGGGGCCGAAGCCGGGGCCGAGACCGGCGCCCAGCCGTCCACCGGG
CTCGCGCTGAGCCTCGTGCTGATCCAGGCGCTCGCCGACACCGGCCTCGCCGCGCCCCTG
TGGACCCTGACCCGGGGCGCCGTCACCACCGGCGCCGACGACCCGCTCACCCACCCCCTC
CAGGCCGCGGTCTGGGGACTGGGCCGGGTCGCCGCCCTGGAGCACCCGCAGCTGTGGAGC
GGCCTGATCGACCTGCCGGCCGCCCTCGACGCCCCCGCCACCCAGCACCTCGTCAGCGCG
CTGGCCGCCGAGGGCGGCGAGGACCAGATCGCCGTCCGCGCCACCGGAGCGTTCGGCCGA
CGCCTGGTGCGCCACCCGCAGGCCGAACTGCCCCCGGCCGACGCGTTCACCGCACGCGGC
ACCGTGCTCATCACCGGCGGCACCGGAGCGCTCGGCGCCGAGGCCGCCCGCTGGCTCGCC
CGCAGCGGCGCCGAGCACCTCCTGCTCACCAGCCGCCGCGGCCCCGAAGCCCCCGGAGCC
GCCGAACTGGCCGCCGAAATCGAGGAGTTGGGTGCCCGCGTCACCCTCGCGGCCTGCGAC
ACCGCCGACCGCGCCGCACTCGCCGCGCTGCTGGACTCCCTACCCGACGAGCACCCGCTG
ACCGGCGTCGTGCACGCGGCCGGTGTCGGCCAGGCGGCCGCCCTCGCCGACACCCCACTG
GCCGACGCCGCACAGGCGATGGCCGCCAAGCTGCTCGGCGCGGCCCACCTCGACAGCCTC
CTGGACGGCCACGACCTGGACTTCTTCGTCCTGGTCTCCTCGATCGCCGGAGTGTGGGGC
AGCGCCGGACAGAGCGCCTACAGCGCCGCCAACGCCTACCTCGACGCCCTCGCCGAGCAC
CGCGCCGCCCGCGGCCTGCCCGCCACCTCCGTCGCCTGGGGCCCCTGGGCAGAGGCCGGT
ATGGCCACCCACGAGGCCGTCACCGACGAACTGCACAAGCGCGGACTGCGCTTCCTCGCG
CCCGCGACCGCGCTCGCCGAACTGCGGCGCGCCGTCGTCCACCGGGACGTCACCGTCACC
GTCGCCGACATCGACTGGGAGCGCTACCACCCCGTCTTCACCTCCACCCGCCCCAGCGCC
CTCTTCGACGAACTGGCCGAGGTCCAGGCCCTGATACGCCCCGAGGACGAAAGCGCCGCG
CCCGAATTCGCCGCGCGCCTGCGGGGCCTGGACCAGGACGGGCAGGAGCGGCTGCTGGGC
GACCTGGTGCGCGCCGAGGCGGCCATCGCCCTCGGCCACGACTCCGCGGATGCCATCGCG
GAGCGGCGGGCCTTCCGCGACGCCGGCTTCGACTCGCTGACCGCCGTGGAACTGCGCAAG
CGGCTCGCCGCCCTCACCGGCCTGGCCCTGCCCGCCACCCTCGTCTTCGACTACCCGACC
CCCGTGGCCCTCGCCCGCCACCTGCGCGAGCAACTCCTGGGCACCGCCCAGGAGTCGGCC
GCCCCCGTGGCCGTACCGTCGGGGGGCTTCGACGAGCCCATCGCCATCGTCGGTATGAGC
TGCCGCTTCCCCGGCGGCGTCCGTTCCCCGCGGCAGCTGTGGGACCTGGTCAGCGAAGGC
GTCGACGCCATCAGCGACTTCCCCGTCAACCGCGGCTGGAACACCGGCCTCTTCCACCCC
GACCCGGACAACCCCGGCACGACGTACTCCACCCAGGGCGGATTCCTGCACGACGCGGGC
GAGTTCGACGCCTCCTTCTTCGGCATCTCGCCGCGCGAGGCGCTGTCGATGGACCCCCAG
CAGCGGCTGCTGCTGGAGACCACCTGGGAGGCGTTCGAGCACGCCGGCATCGACCCCACC
ACCGTCCACGGCACCACGACCGGCACCTTCATCGGCTCCACCTACCAGGAGTACGGACTC
GGCGTCGAGGACGGCTCCGCCGGTCACCTGGTGACCGGCACCAGCCCCAGCGTGCTCTCC
GGGCGCCTGGCCTACCTCTTCGGCCTCGAAGGCCCGGCCGTCACCGTCGACACCGCATGC
TCCTCCTCCCTGGTCGCCCTGCACCTGGCCTGCCAGTCGCTGCGCAACGGCGAGAGCTCC
CTGGCCCTGGCCGGCGGCGCGACCGTGATGACCAACCCCAACCCGTTCGTCGCCTTCAGC
CGGCAGCGCGCCCTGGCAGGCGACGGCCGCTGCAAGGCGTTCTCCGAAGGCGCCGACGGC
ATGACCCTGGCCGAGGGCGTGGGCGTCCTCGTCCTGGAGCGCCTCTCGGACGCCCAGCGC
AACGGGCACGAGATCCTCGCCGTCGTCCGCGGCTCGGCCATCAACCAGGACGGCGCCTCC
AACGGCCTGTCCGCCCCCAACGGCCCCTCCCAGCAGCGCGTCATCCGCCAGGCCCTGGCC
AACTCGGGGCTGACCCCGGCGGACATCGACGCCGTCGAGGCCCACGGCACCGGCACCGCC
CTCGGCGACCCCATCGAGGCCCAGGCCCTGCTCGCCACCTACGGACCGGGCCGCGACCCG
GACAGTCCGCTGCTGCTGGGCTCGGTGAAGTCCAACATCGGCCACACCCAGTCGGCCGCC
GGCGTGGCCGGCGTCATCAAGATGGTCCTGGCCCTGCGCAACGGACAGCTGCCGCGCACC
CTGCACGCCGACACCCCCTCCAGCCACATCGACTGGACCCCCGGCACCGTCTCCCTGCTG
ACCGAACCCACCGACTGGCCCGAGGGCGAGCGCCCGCGCCGCTGCGCGGTCTCCTCCTTC
GGCATCAGCGGCACCAACGCCCACACCCTCCTCGAAGAGGCCCCCCGCCCGCACGAGGCG
ACCCCCGCGGGGCCGGTGCCCCCGGCCGGGGACGCCATCCCCTGGGTGCTGTCCGCCCGG
ACCCCGGGCGCGCTGCGCGCCCAGGCGGCCCAGCTCGCCGCCCACCTCGACGGCGAGGCA
CCCGATGCCCTCGACGTCGGCCACACCCTGGTGGCCGCGCGCACCCTCTTCGACCACCGC
GCCGTCGTCGTCGGCACCGACGACGCATCCCGGCGCGCGGCCCTGGACGCCCTCGCCACC
GGCGGCTCCGCACCCGGCATCGTCCAGGGCACGGCCGACACCGACGGCAGGACCGTCTTC
GTCTTCCCCGGCCAGGGCTCCCAGTGGGCCGGCATGGGAGCGCGGCTCCTTGAGGAGTCC
CCGGTCTTCGCCGCGCGCCTGACCGAATGCGCCACCGCCCTCTCGGAGTTCGTCGACTGG
TCCCTGCTCGACGTGCTGCGCCAGGCCGACGGCGCGCCGACCCTGGACCGCGTCGACGTC
GTCCAGCCCGCCTCCTTCGCCGTCATGGTCTCCCTGGCCGCGCTGTGGACCTCCCACGGC
ATCACCCCGGACGCCGTGGTCGGCCACTCGCAGGGCGAGATCGCCGCGGCCGCCGTCGCC
GGGGCGCTCTCCCTGGAGGACGCGGCCCGCGTCGTCGCGCTGCGCAGCCAGGCCATCGCC
CGCGGGCTGGCCGGAACCGGCGGCATGCTGTCGGTCCCGCTGCCCGCCGCCGACGTCGAA
CAGCGCCTCGCCGCCTATGAGGACCTGTCGATCGCCGCCGTCAACGGCCCCCGGTCCACC
GTCGTCTCCGGCGCCACCGCGCCGCTGGACGCCCTCCAGGCCGAACTGGTCGGCGAGGAC
ATCCGTGCCCGGCGCATCGCCGTGGACTACGCCTCGCACTCCGCCCAGGTCGAGCGGGTG
CGCGACGAACTGCGCACCGTCCTCGAACCGGTGCGCCCGCGCCCGGCGCAGGTGCCCTTC
TTCTCCACCGTCACCGGTGACTGGCTGGACACCACCGTCATGGACGCGGAGTACTGGTTC
ACCAACCTGCGCCGGACCGTCCACTTCCAGCCCGCCATCGGCGAACTCCTCGCCCAGGGC
CACCACTTCTTCATCGAGGTCAGCTCCCACCCCGTCCTGTCCATGGGCATCCAGGCGACC
GCCGAGGAAGCCGGGGCCGCCGCCGCGGTGCTCGGCACGCTCCGGCGCGACACCGGCGCC
ACCGACCGCTTCCTGGCCTCCCTGGCCGAAGCCTTCGTCCGGGGCGCGGACGCCGACTGG
TCCGCCGTCTTCGCCGGCACCGGCGCCCGCCGGGTGCCGCTGCCCACGTACGCCTTCCAG
CGCGAGCACCTGTGGGCGATCCCCGAGCGGTCCCCGGACCGGCCCGAAGCGGATCCCGCG
GACGCCGAGTTCTGGACGGCGGTCGAGGAGGAGGACGTCGAGGCGCTCGCCTCCCGGCTG
CGCCTGGACCGCACCTCCCTCGCCCCGGTCCTCCCGGCCCTCTCGCACTGGCGCAAGCGC
CGCCGCGAGCTGTCCACCGTGGACTCCTGGCGCTACCGCGCCACCTGGAAGCCGCTGACC
GGCCTGCCCGCGGCGGCCCTGACGGGCACCTGGCTCGTCGTCGCCCCCGAAGGAGCCGAC
ACCGACACCCTCACCGGTGTCCTCGCCGCCCACGGCGCCGGGACGCGCACCCTCGTCCTG
GACGACAGCTGCGCCGACCGCGCCACCCTGACCGCGCGCCTGACCGGCCTCGACGGCGCG
GCGGACCTCACGGGCGTGGTGTCCCTGCCGGCCCCGGCAGACGAGGCAAGCGCCACCCAC
CCGACGCTCAGTCGCGCGGTGACCCTGACCGTCGCGCTCGTCCAGGCGCTCGGCGACGCC
GGAATCGACGCACCCCTGTGGTGCCTGACCCAAGGCGCCGTCTCCACCGGTCGCGCGGAC
CGGCTCACCCGCCCCGACCAGGCCCAGATCCTCGGCCTCGGCTGGACGGCCGCGCTCGAA
CACCCGCAGCGCTGCGGGGCCGGCCTGGTCGACCTGCCCGAGGAGCTGGACCGGCGGGCC
GGCGAGCGCCTGGCTGCCGTCCTGACCGGCCGCAGTGGCGAGGACCAGCTCGCCGTCCGC
TCCTCGGGCGTCTTCGCCCGCCGCGTCGTCCGCGCCGCCCCCGCGGACCCCGCCCCGGCC
CGCCCCTGGACGCCGAGGGGCACCACCCTCGTCACCGGCGGCACCGGCACCCTCGCCCCG
CACCTGGCCCGCTGGCTCGCCCAGCAGGGCGCCGAGCACATCGTGCTCACCAGCCGCCGC
GGCCCGGCGGCACCCGGCGCAGCGGAACTCGTCCAGGAACTGGCCGAGTTGGGCTGCCAG
GCCGAAGCGGTGGCCTGCGACCTGACCGACCGCGACGCGGTCGCGCAGATGCTCGCCGCG
CTTCGGGCCGAGGGCCGCACCGTACGCACCGTCGTGCACACCGCCGTCACCATCGAGCTG
GCGCCGCTGGACGAGACGACCCTGGACGACTTCGCGAAGGTCATGGACGCCAAGGTCATC
GGCGCCCGGCACCTGGACGAACTCCTCGGCGACGACCTGGACGCCTTCGTCCTGTACTCC
TCCACCGCCGGTATGTGGGGCAGCGGCGCCCACGCCGCCTACGTCGCCGGAAACGCCTAT
CTCAACGCCCTGGCCGAACACCGCCGCGCCCGCGGCGCCCGCGCCACCGCCGTCTCCTGG
GGCATCTGGGCCGACGACCTCAAGCTCGGCCGCGTCGACCCCGGCCAGATCCGCCGCAGC
GGGCTGGTCTTCATGGATCCCCAACTCGCCCTCACCGGCCTGCGCCAGGCCCTCGACGAC
GAGGAAACGCACCTGGCCGTCGCCGACGTGGACTGGGGGCGCTACTACCCCGTCTTCACC
GCCGCGCGGCCCACCCGGCTCTTCGAGGACCTGCCCGAGGTGCGGCAGCTGGCGCAGGAG
AGCGCCGAAGTCACCGACTCCGGCAGCGAGTTCGCCACCCGGCTCGATGGGCTGGCCGCG
GTCGAGCAGGACCGCCTCCTGCTGGATCTCGTCCGTACCGAGGCGGCCACCGCGCTCGGC
CATGCCTCACCCGACGTGCTCTCCGAACAACGTGCCTTCCGCGACGTCGGCTTCGACTCC
CTGACCGCCGTCGACCTGCGCAACCGCATCGCCTCCGTGACCGGGCTCGCCCTGCCGAGC
ACCATGGTCTTCGACTACCCCAACCCGCTCGCACTCGTCGCGTTCCTGCGCGAGTCCCTC
GCCGGGTCCGCCACCGGCACCGCCGCCACGACCACGCACACCGCCGCCGCCGACGAGCCC
ATCGCCATCATCGGCATGAGCTGCCGCTATCCCGGCGGCGTCGGCTCACCGGAGGACCTG
TGGCGACTGGTCACCGAGGGCGGCGACGCCACCGGAGAGTTCCCCGCCGACCGCGGCTGG
GACGCCGAGGGCCTCTACGATCCCGACCCCGACCGGGCCGGCCACACCTACTCGACCCGG
GGCGGCTTCCTGCATGACGCCGCCGACTTCGACGCCTCCTTCTTCGGCATCTCGCCCCGC
GAGGCCCTGGCCATGGACCCCCAGCAGCGCCTGCTGCTGGAGACCTCCTGGGAGGCGATG
GAGCGCGCCGGGATCGACCCCGCCACCCTGCGCGGCAGCAGCACCGGCACCTTCATCGGC
GCCAGCTACCAGGACTACCGCGCCTTCGGCGCGGGCCCGGACGGCGCCGAGGGACACCTG
ATCACCGGCACCATCTCCAGCGTCCTGTCCGGCCGGCTCTCCTACACCTACGGCTTCGAG
GGCCCGGCCGTCTCCCTCGACACCGCCTGCTCCTCCTCCCTGGTCGCGCTGCACCTGGCC
TGCCAGTCCCTGCGCAACGGCGAGAGCTCCCTGGCCCTCGCGGGCGGTGTCAGCATCATG
TCCACGCCGGGCGCGTTCGTCGGCTTCAGCCGGCAGCGCGCGATGGCGGCCGACGGCCGC
TGCAAGGCGTACTCCGACCAGGCCGACGGCATGAGCCTGGCCGAAGGCGTCGGCCTCGTC
CTCGTCGAGCGGCTCTCCGACGCCCGCCGCAACGGGCACCAGGTCCTGGCCGTCATCCGG
GGCTCCGCCGTCAACCAGGACGGCGCCTCCAACGGACTGACCGCGCCCAACGGCCCGTCC
CAGCAGCGCGTCATCCGGCAGGCCCTGGCCAACGCCGAGGTGGACCCCGACGGCATCGAC
GTCATCGACGGGCACGGCACCGGCACGGCACTCGGCGACCCCATCGAGGCGCAGGCCCTG
CTGGCCACGTACGGCCAGGGCCGCGACCCCGAGCACCCGCTGCTCCTGGGCTCCGTCAAA
TCCAACATCGGCCACACCCAGATGGCGTCCGGTGTCGCCAGCGTCATCAAGATGGTCATG
GCCATGCGCCATGCCGCGGTGCCGCGGAGCCTGCACATCGACCGGCCCTCCAGTCACGTC
GACTGGAGCTCCGGCGCCATCCAGCTGCTCACCGAGCCGCTGCCCTGGCCGGCCACCGGG
CACCCGCGTCGCGCGGGCGTCTCCTCCTTCGGACTCAGCGGCACCAACGTCCACACCATC
CTCGAACAGGCCCCGGAGGACCGGACCGAGGAGGACACCGACACCGCACCGGCCCGCCCG
GCCGACCCCACACCCGTCCCCGTGACCCTGTCCGGACGCACCGAAGCGGGCCTGCGCGCC
CAGGCCGGACGGCTCCTGACCCACCTCGCCGACCACCCCGAACTTCCGCTCACCGACCTC
GCGTTCTCGCTCGCCACCTCCCGGGCCGCCCTGGAGCACCGTGCGGCCGTCGTCACCGAC
GACCCCGACACCCTCACCCGCGCCCTGACCGCGCTGCGCGACGCGACCCCCGACGGCGGA
CTGCTCACCGGCCGCCCGGACCGCGGCCGGCTCGCCTTCCTCTTCACCGGCCAGGGCAGC
CAGCGCCCCGGAATGGGACGCGAGCTCTACGACCGCCACCCGGTCTACGCCGAGGCCCTG
GACGCCGTACTGGCCCGCTTCGACCTCGAACTCGACCGCCCGCTGCGGGAGATCCTCTTC
GCCGACCCCGGCACCCCCGAGGCCGAACTGCTCGACGACACCGGCTACACCCAGCCGGCC
CTGTTCGCCCTCGAAGTGGCGCTGTTCCGTCTCGCCGAGTCCTGGGGCCTGCGCCCCGAC
TACGTCGCGGGACACTCCATCGGCGAGCTCGCCGCCGCGCACGCCGCAGGAGTCCTCTCC
CTGGAGGACGCCTGCACCCTCGTAGCGGCTCGCGGCCGGCTGATGGCCGCCCTGCCCTCC
GGCGGCGCCATGGCCTCCGTCGAGGCCACCGAGGACGAGGCGGCCGCCGTGCTCGCCCCG
TACGAGGGACGAGCCGCGGTCGCCGCCGTCAACACCCCCACGTCCCTGGTCGTCTCGGGC
GACGAGGACGCGGTACACGCCGTGGCGGCCCACTTCCACGAACTCGGCCGCCGCACCAAG
CAGCTGCGCGTCAGCCACGCCTTCCACTCGCCGCATATGGACGCGATGCTGGACGACTTC
ACCCGCGCCGCCGAAGGCATCACCTTCCACGCGCCGGAGCTGCCGCTGGTCTCCACCCTC
ACCGGAGAGCTGATCCTGGCCGACGACCTGTGCTCGGCGCCGTACTGGACCCGGCAGGTC
CGCGGCACCGTCCGCTTCGCCGACGCCGTACGGCACCTCACCGAGCACGGTGTGACGACC
TTCTTCGAGCTCGGCCCGGACGCCGTACTCAGCGGCGCGGTACGCGAGAGCACCGGCGAG
CAGACCCCCGCCACCGCCGTCCCGGCACTGCGCCGCGACCGGCCCGAGGCCCCCGCACTG
ACCACGGCACTGGCCCGGCTCCACCTCCACGGGGTGCGGGTCGACTGGGACGCCGTGTTC
GCGGGCGGCGGCGCCCGGCGGATCGACCTGCCCACCTACCCCTTCCAGCGCGAGCGCTAC
TGGCCCGAGGCGGCCGCCGGAGCCGCCGCACCCGCACACCCCGCCGACGCGGCGGACGCG
GAGTTCTGGTCGGCCGTCGAGCGCGCGGACCTTCCGTCCCTGGGCTCCTCGCTGGACCTG
GACGACGACACCCTCACCGCCGTCGTGCCCGCCCTCTCCTCCTGGCGGCGCAAGAGCCGG
GAGCGCTCCACCGTCGACGGCTGGCGCTACCGGACCACCTGGAAGCCCCTCACCGGCACG
GCCACCGCCGGACACCCGGCCGGGACCTGGCTGGTGCTCGCACCGGCCGACGGCGACCGG
GCCTGGACCGATGCGGTCGCCGGGGCCCTGGGCGCCGACGCCGTACGGGTCGAGGTGAGC
ACCGCCCAGCGCCAGGAGCTGGCCGAGCGGCTGAGCGAACTGGCCGCGGAACACGGTGAG
TTCGCGGGCGTACTGTCCCTGCTGGCAACGGCCGGCGAAGGCGCAGAGGATGCCGATGAC
GCCACGACCGAGGGCCTCCTGCTGACGGCGACCGCCCTCCAGGCCCTGGGCGACGCAGGT
ATCGACGCCCCGCTGTGGTGCGTGACCCGTACCGCCGTGGCCGTGGACCGCGCCGAACAC
CCGGCCCGCCCCGCCCAGGCCGCCGTCTGGGGCCTGGGCAGGGTCGCCGCACTGGAGCAC
CCGCAGCGCTGGGGCGGCCTCGTCGATCTCCCCGACGAGCTCGACGGCGCCACCCTGCGC
CGCCTGGCCGCCGTCCTCGCCGACAGCGGCGACGAGGACCAGCTCGCCGTACGGACCACC
GCGACCTTCGTCCGCCGCCTGGCGCACCACCGGGCCGCACCGGCCCCCGAGGCAGCCACG
TTCCGCCCCACCGGAACGGTGCTCGTCACCGGCGGCACCGGTGCGCTCGGCGGCCACGTC
GCCCGCTGGCTGGCCGAGGCGGGCGCCGAACATCTGCTGCTGGTCAGCCGGCGCGGCACC
GACGCCCCCGGCGCCGGTGAACTGGCGGCTGAAATCGCCGAGTTGGGTGCTCGCGTCACC
GTCGCGGCGTGCGACACCGCCGACCGGGACGCGCTCGCCGCCGTACTGGCCGCGATCCCC
GACGAGCACCCGCTCACCGCGGTGTTCCACACCGCCGGCACCGTCGACGACGGCACCCTG
GACACGCTCACCCCCGAGCAGTTCGCCTCCGTCCTGCGCACCAAGGTCACCGCCACCCGC
AACCTGCACGAGACGACCCGCGAGCAGGACCTGAGCGCCTTCGTGCTCTTCTCCTCCGTC
GCCGGCACCCTCGGCGCACCCGGCCAGGGCAACTACGCCGCCGGCAACGCCTTCCTCGAC
GCCTTCGCCGCACACCGCCGCGCCCACGGCCTGCCCGCCACCTCGCTGGCCTGGGGCCCC
TGGGCCGAGACCGGTATGGCGGCCGACGGCACCGGCATCCAGGACCGCGTCCGCCGCGGC
GGCTTCACCCCCATGCCGCCCCGGCTCGCCCTCACCGCACTGCGCCGGGCGATCGAGCAC
GACGCCACGGCGCTGACCCTCGCGGACATCGACTGGCAGCGCTACGCAGAGGTCTTCACC
GCGACCCGCCCCAGCCTCTTCGTCGCCGACCTGCCCGAACTCCAGCAGGTCACGCCGCCC
GCCGGGACACCGGAAGCCGCTCTGCGGGAACCGGCCCTGCGCCAACGGCTCGCCGGACTC
TCCCCGGCCGCGCGCCCGCGCTTCGTCCTGGACCTGGTACGCACCCAGGTGGCCGCGGTC
CTCGGGCACAGCGGCACCTCGGCCATCGGCGCCGAACGCGCTTTCAGTGACCTCGGCTTC
GACTCGCTGACCACCGTCGAACTGCGCAACACCCTCACGGCCACCACCGGCCTGAAACTG
CCCGCAACCCTCGTCTACGACTACCCGACCCCGACCGCCCTCGCCGACTTCCTGCTCGCC
GAACTCCTGGGCGCCCTGCCCGAGTCCGGTGCCCCGGCCTTCGTCGGCCGCGCGGCGGAC
GACGATCCCATCGTCATCGTCGGCATGAACTGCCGCTTCCCCGGCGGCATACGGTCCCCC
GAGGACCTCTGGCAGCTGCTGAGCAGCGGCGAGGACGCGATCAGCGGATTCCCCGCGGAC
CGCGGCTGGGACCTCGACGCGCTCGCCCGCGGCGCCTCCGCCACCCTCGAAGGCGGATTC
CTGGACGGCGTCGGCCTCTTCGACGCCCCCTTCTTCGGCATCTCGCCCCGCGAGGCCCTG
GCCATGGACCCCCAGCAGCGCCTGCTGCTGGAGACCTCCTGGGAGGCGTTCGAACGCGCC
GGAATCGACGCGACCACCCTGCGCGGCAGCCGTACCGGCGTATTCGTCGGCACCAACGGC
CAGGACTACGCCACACTCCTGCGCCAGGGCACCGGCACCACCGACATCCGCGGCCATGTC
GCCACCGGCAACACCGCCAGCGTCATGTCCGGCCGCCTCTCCTACGCCTTCGGCCTGGAG
GGCCCGGCCGTCACCGTCGACACCGCCTGCTCCTCCGCGCTGGTCGCCCTGCACATGGCC
GCGGGCGCCCTGCGCAGCGGCGAGTGCACCCTCGCCCTGGCCGGCGGCGTCTCGGTCATG
TCCAGCCCCGACTCCTTCACCGAGTTCACGGTCCAGGGAGGGCTGGCCCCCGACGGACGG
TGCAAGCCGTTCGCCGATGCGGCCGACGGTACGAGCTGGTCCGAGGGCGTCGGCGTCCTC
CTCCTGGAACGGCTCTCCGACGCCCGCCGCAACGGCCACGACGTCTGGGGCATCGTGCGC
GGCACCGCGGTCAACCAGGACGGCGCCTCCAACGGGCTGACCGCGCCCAGCGGCCGGGCC
CAGCAGCGCGCCATCCGCCAGGCCCTGGCCGACGCCGACCTCGCCCCCGCCGACGTCGAT
GTGGTCGAGGCCCACGGCACCGGCACCACCCTCGGCGACCCCATCGAGGCGCACGCCCTC
ATCGCCGCCTACGGACAGGACCGGCCGACGGACCGGCCGCTGCTGCTCGGCGCCGTGAAG
TCGAACCTGGGTCACACCCAGGCCGCCGCCGGTGTCGCCGGCACCATCAAGGTGCTGCTG
GCGATGCGCCACGGCGTGCTGCCCAAGACCCTGCACACCGACTCGCCGTCCGCGCACGTG
GACTGGACGGCCGGCACGGTCTCGCTCCTCACCGAACAGCAGGAGTGGCCCGAGACCGGG
CACGCCCGGCGGGCCGGTGTCTCCGCCTTCGGCGTCAGCGGCACCAACGCCCACGTCATC
ATCGAGCAGGCGCCGGACGCCGAGGAGTCCGTGGCGCCGGAGCCCACCACGGTGCCGGGC
CTCGTGCCCTGGCCGGTGTCGGGCAAGTCCGAGGCCGCCCTGGAGGCAGGAATCGAGCGG
GTCTCGGCGCTGACCGGCCGGTCACCGGTCGACGTGGGCCACTCCCTCACCACGGGCAGG
GCGGCCTTCACCCACCGCGCGGTCCTCGCGGCCGACGGCGCGGGCGTACGGGAACTCGCC
CGCGGCGTCGCCCACGAGGCCGACGGGAAGCTGGCGGTGCTGTTCTCGGGCCAGGGCGCT
CAACGCGTCGGGATGGGCCGGGAGTTGTATGTCCGGTTCCCGGTGTTCGCCGAGGCGCTG
GACGGGGTGCTGGCGCACTTCGATGCCGGGTTGCGGGACGTGATGTTCGGTGATGCGGAG
GGCTTGGACGAGACGGGGTTCACGCAGCCCGCGCTGTTCGCCATCGAGGTGGCGTTGTTC
CGGCTGGCCGAGTCCCTGGGTGTGCGGCCGGATTTCGTGGGCGGGCACTCGATCGGTGAG
ATCGCGGCGGCGCATGTCGCCGGGGTGTTCTCGCTGGCGGATGCGTGTGCGCTGGTGGCG
GCCCGTGCGCGGCTGATGCAGGCCCTCCCGGCGGGCGGCGCGATGGTGGCCGTCCAGGCA
ACAGCGGAGGAGGCGGCCGCACGGCTGGTCGACGGGGTGTCGATCGCGGCGGTCAACGGC
CCGGAGGCGGTGGTGATCGCCGGGGAGCAGCGCGAAGTCCTGCGGATCGCCAAGGAGTTC
ACCGGCCTGGGTCGTAAGACACGGCGCCTGCCGGTCAGCCACGCCTTCCACTCGCCGCTG
ATGGAGCCAATGCTGGAGGACTTCCGGCGGGTCGCCGAGGGACTGTCGTACGAAGCCCCG
CGGATCGCGCTGGTGTCGAACCTCACCGGCGAACTCGCCACCGAGGACCTCGTCCGCTCG
GCCGAGTACTGGGTCCGGCATGTGCGCGAGACCGTGCGCTTCGCCGACGGCGTGAGCGCC
CTGGCCGCCGAAGGAGCCTCCGTCTTCCTGGAGCTGGGCCCGGACGGGGTGCTGACCGCG
ATGGCCCAGCACACCCTGGACGGCACCGCGACCGCCGTACCGGCCCTGCGCAAGGACTGG
TCCGAGGAGACCGCGCTGCTGACCGCGCTCGCCCAGCTGCACGTCGTAGGCGTGGGGGTG
GACTGGTCCGGGATCTTCGCCGGCACCGGTGCCCGCCGTGTCGACCTGCCCACCTACCCC
TTCCAGCACCAGTGGTACTGGCCGGACGGCGCACCCGCCGCGGAGGCGACGACCGGTGCG
CAGGACCCCGTGGACGCCGAGTTCTGGGACGCGGTGGAGCGCGCGGACCTCTCGTCGCTC
TCCGACAGCCTCGAACTGGACGACGCCGCACTGTCGGCCCTCGTGCCCGCCCTGTCCGCC
TGGCGCCGCAAGCGCGTGGAGCGCTCTACCGTCGACGGCTGGCGCTACCACGTGACCTTC
AAGCCGCTGACCGGCACCGCGCCCGGCACCCTCGCCGGAACGTGGCTGGCGCTCGTCCCG
ACGGGAGCCGCCGACGACGAGTGGACCACTGCCGTACTCGCAGCCCTCGGCGATGCGGTC
GTCATCGCGGAAGTCGATCCGGCCGACCGCGGTGCGTTCGCCGGACGGCTCGGCGAACTC
GCCGAACGGGGAACCGAGTTCACCGGCGTGGTCTCCTCCTCGCAATCCCGTACGCCTTCG
CCCTCCCCTTCGGACCGGCCTGGCCCGACGAGGCGGTGGCGGGCACTGGCCGAGGCGGGC
ATCGACGCCCCGCTGTGGTGCGTCACCCGCGACGCGGTGCCGGTGGACCGCTCGGAGAGC
GAAGTCAGCCCCGCCCAGGCGGCGGTGTGGGGGCTCGGCAGGGTCGCGGCCCTGGACCAC
CCGGACCGCTGGGGCGGCCTGGTCGACGTACCGCAGGAGCACGACCGGCGTACGGCGGAA
CGGCTTCGCGCCGTACTGTCCGGCGCCGGCGACGAGGACCAGGTGGCACTGCGGCCCTCC
GGCGCCTTCGGACGACGGCTGGTGCGCGCCACGGACGACACCCCCGCGACCCCGTGGCAG
CCGGCCGGCACGGTCCTGGTCGTCGGCCCCGCGTCCGGCACCGGCGGACACTGCGCCCGG
TGGCTCGCCGGACAGGGTGCCCAGCACCTGGTGCTGGCCGACCGCACCGCACCGGACACG
GCGCAGCTGATCGGCGAACTCGACGCCCTGGGCGTGCCGTTGACGGTGCTCGACTGCGCA
CCGGCCGACGGTGAGGCGCTGCTGAGCGCGCTCGCCGCGCTCCCGGAGCCGCTGACCGCC
GTGATCTACGCGGACGGGCCGTCCGACGCCGACGCCTACGGAACCGCCACCACCGCGGAC
CCCGGCGCATCCCTGGCCGCGCTGTACGCGGACGTGGAGAGCCTGGCGGCCGTGGCCGAG
GCGGCGACCGGCGCTCGCCCCCTGGGCGCGTTCGTCCTCTTCTCCTCGATCGCCGGGACC
TGGGGTGCCGGAGGCCGGGGCACCGAGGCCGCGGCCGGAGCCCAACTCGACGCCCTGGCA
GGTATGTTGCGTGCCCGAGGACTGCCTGCCACGGCGGTCTCGTGGGGCGGCTGGGCCGAC
GCCACCTCCGGCAGCCTGGCCGCACACCTGCGGGCCAACGGGCTGCCCCCGATGGACCCC
GCGCGGGCCCTGACCGCGCTCGCCCGCTCCCTGGGCACCGACACCCCCTCGGTGACGGTC
GCCGACGTACGGTGGGACGAGTTCGCGCCCGCCTTCACCCGCAGGCGGCACAGCGCCCTG
TTCGCCGAACTCCCCGAGGCCCGCGAGGCGCTGGCGGAGTCGGACGGCAGCGCGCCGGGA
ACGGCGGATGCCGCGTCCGGCCTGCGGGCCGAACTCGCCGCCCGCCCGGACGCGGAGCGC
ACGGAGCACCTGCTGGCCCTGGTCCGCGACCGCGTGGCGGCCGTGCTCGGGTTCGCGGAC
GCCGACGCCGTACCCTCCGGCCAGGCGTTCACGGACCTCGGCTTCGACTCGCTGACCGCG
GTCGACCTGCGCAACCAGCTCGCCGTCGCGACGGGTCTGGCCCTGCCCGCCACCCTCGTC
TTCGACTACCCCACGGCCGACGCGCTCGCCGGTTACCTGCGGGCCGAACTCCTCGGCGAG
GGCGGGAAGGACGCGGAGGAACTCCCCGCGGTGGTGCGGACGAAGGACGCCGACACCGCC
GAGGACCCGGTCGTCATCGTCGGCATGAGCTGCCGCTACCCGGGTGGGATCCGCTCGCCC
GAGGACCTGTGGCAGCTGGTCATGGGCGAAGCGGACGCCATCGGAGGCTTCCCCACCGAC
CGCGGCTGGGACCTGGACCGGCTGCTGCACGGCGACCGGGACGGCCGCGGCCGGACCGTC
ACCGGCCAGGGCGGATTCCTCTACGACGTGGCCGACTTCGACCCCGGGTTCTTCGGCATC
GCGCCGCGTGAGGCGATGGTGATGGACCCGCAGCAGCGCATCCTGCTGGAAGCCACCTGG
GAGGCCCTGGAGCGCACCGGCATCGACCCCGCCCGGCTGCGCGGCGGCGACACCGGCGTG
TTCATCGGCGGCGGCTCGGGCGACTACCGGCCCGAAGCGGGCCAGCTGGGGCATGCGCAG
ACCGCGCAGTCGGCGAGCCTGCTCTCCGGCCGGGTGGCCTACCACTTCGGCCTGGAAGGA
CCCTCCGTCAGCGTCGACACGGCGTGCTCGTCGTCCCTGGTGGCGCTCCACCTGGCCGCC
CAGGCCCTGCGCAACGGCGAATGCTCCATCGCCCTGACCGGCGGTGTGACGGTGATGTCC
AGCCCGGTGAACTTCGTCGAGTTCGGCGAGATGGGAGCCCTGGCACCGGACGGGCGCTGC
CGGCCGTTCGCGTCCGCCGCGGGCGGCACCGGCTGGTCCGAGGGCGTGGGCGTCCTCGTC
CTGGAACGGCTCTCCGACGCCCGCCGCAACGGGCACGAGGTGCTCGCGGTACTGCGCGGC
TCGGCCGTCAACCAGGACGGCGCCAGCAACGGCATCACCGCGCCCAACGGCCCCTCGCAG
CGCCGCGTCATCCAGCGGGCGCTGGCCAACGCGGGGCTGGCGCCGGCCGACGTGGACGCC
GTGGAGGCACACGGCACCGGCACCACCCTGGGCGACCCCATCGAGGCGCAGGCGCTGCTG
GCCACGTACGGGCAGGGCCGTGACCCCGAACTGCCCTTGCTGCTGGGCTCGGTGAAGTCC
AACATCGGCCACACCCAGGCGGCCGCCGGCATCGCCGGTGTGATCAAGATGGTGCTGGCG
ATGCGCCACGGCATGCTGCCCAGGAGCCTGCACATCGACGAGCCCTCGGCACATGTCGAC
TGGAGCGCCGGGGCCGTCGAACTGCTGGCGCAGGCGGCCGACTGGCCGCGTACCGGCCGC
CCGCGACGGGCCGGAATCTCGGCCTTCGGCGCCAGCGGCACCAACTCCCACGTGATCATC
GAGCAGCCCGCACCGACCGTTGCGGAGGAGCCCGAGCGCCCGCAGGAGGCGGGCGGCCCG
CTGCCGGTGCCGGTGTCCGGCGCCGTACCGGACGCGCTGCGGGCCCAGGCCCGGCAGCTG
CACGCCTACGTGGCCGGTCGGCCCGGCCTCACCGTCGCCGAGTTCGCGCTGTCCACCGCC
ACCACCCGGTCGGCCTTCACCCACCGGGCCGCCGTCCTCGCCGAAGACCGCGAGGAACTG
CTCGCGGGTCTGGCCGCGCTCGCCGGCGGGCTCGACACCCCCCAGGTCCTGCGGGGCCGG
GTCGCGGAGCGCCGCGGCAGGCTCGCGGTGCTGTTCTCCGGCCAGGGATCGCAGCGCGTG
GGCATGGGACGGGAACTGCACGCCCGCTTCCCGGTGTTCGCGGAGGCCCTGGACGAGGTG
ACGGCACGCCTGGAAGCGGAACTGGAACTCCCGCTGCGGGAGGTCATGTTCGGCGACTCG
GAGCGGCTGAACGAGACGGGCTACACCCAGCCCGCGCTGTTCGCGATCGAGGTCGCGCTG
TTCCGTCTGGTCGCCTCCTGGGGCATCCGCCCGGACTTCGTCGCCGGGCACTCCATCGGC
GAGATCGCGGCCGCGCACGTGGCCGGGGTCTTCTCCCTGGACGATGCGTGCCGGCTGGTG
GCCGCACGGGCGCGGCTGATGAACGCCCTGCCCGCGGGCGGCGCCATGGTGGCCGTCCAG
GCCACCGAGGAGGAGACCCGCGCCTGCCTGACCGACGGCGTGTCCATCGCCGCGGTCAAC
GGACCGCGCTCGGTGGTCCTCTCCGGCGACGAGGCCGCCGTACTCGACCTGGCGGAGAAG
TTCACCGCCGACGGGCGCAAGACTAGGCGTTTGCGGGTGAGCCATGCATTTCACTCACTG
CACATGGACGCCGTTCTCGACGACTTCCGACGAGTCGCCCAAAGCGTCGGCTACGACGCC
CCCACGATCCCGCTCGTGTCCAACGTGACCGGCGAGGCGGCGACCGAGCGGCAGGTGTGC
TCCCCCGACTACTGGGTGCGCCACGTCCGCGAGGCCGTCCGCTTCGGCGACGGTGTCCGC
ACCCTCGCCGACCGCGGAGTGACCGCGTTCCTGGAGCTGGGCCCCGACGGCGCGCTGTGC
GCCATGGCCCAGGAGACCCTGGACACCCTGCCCTCGCCGGCGGTCACCGTACCGGCGCTG
CGCAGGGACCGCGGTGAGCAGGAGTGTGTGGTCACCGCGCTCGCCCGGCTGCACGTCGAC
GGAGTGAGCCCGCACTGGCCCGCCGTACTCACCGGGCCCCGGACCGCGCCCCGCCGCACC
GACCTGCCCACCTACCCCTTCCAGCACCAGCGGTTCTGGCCGGCCGCCCAGCCCGCCACC
GACCCCACCCCGGCGACCGCCGCGGACGACGGCTTCTGGTCGGCGGTGCGGGAGGCGGAC
TTCGCGGACCTCGCCACGACGCTCGACGTCGAGCGCGACGCGCTGTCCACGGTGCTCCCC
GCGCTCGCGGACTGGCGCCGCAGGCGCGAGGAGTCCGGCACGGTCGACGGCTGGCGGCAG
CAGATCACCTTCGAGCCGCTGACCCGCACGCCCTCCCACACCCCGGCGGGCACCCGGCTC
GCCGTGATCCCGGCAGGGCATGAGCAGGACCCATTGGTCGCCGATGTCGTCGCGGCCCTG
GGCCCGGACACCGTACGCCTCACCGCGCCCGGCAGCGACCGGGCCGCCCTGGCCGACCTG
CTGCGCCAACAGGCCGCCGACGGAACCGAGTTCACCGCCGTGGTCTCCCTGCTCGCCCTC
GCCACGGAGCCCGCCCACTCGGAGCCCGCCCACTCGGAGCCCGCCCACCCGGCGCACGCC
CCCGAGGCGCTGGCCCTCACCACCACCTTGATCCAGGCGCTCGGCGACGCGGACCTTGCC
GCACCCCTGTGGTGCGTCACCCGCGGCGCGGTCGCCGCTGCGCCCGGCGAGCCGGTGTCC
GGACCCGCCCAGGCCGCCGTATGGGGACTGGGTCGGGTGGCCGCCCTGGAGTACCCGCAG
CGCTGGGGTGGTCTGATCGACCTGCCCGCCGCTCTGGACGACCGCACCGCCGCCCGTCTC
GCCGATGTGCTCGCCGCCCCCGGCGGCGAGGACCAGATCGCGATCCGGCCCTCCGCCGTC
CTCGGCCGCAGGCTGGTCCCCGTACCGGCCGGGCGGACCACCCGGGAGTGGAACCCCACC
GGAACCGTCCTGATCACCGGCGGCACCGGAGCACTGGGCGCCCGCGTGGCACGGGAACTG
GCACGGGCGGGCGCAGAGCACCTGCTGCTGCTGAGCCGCCGGGGCCCGGACGCGCCCGGC
GCGGACGCACTGCGGGCCGAACTCACCGCGCTCGGCGCGGACGTCACCCTCACCGCATGC
GACGCCGCCGACCGCGACGCGCTCGCGAAGGTCCTGGCGGACATCCCCGAGACGTCCCCC
CTGACCGGCGTCGTCCACACCGCCGGCGTCATCGACGACGGTGTCCTGGACAGCCTCACC
CCGGACCGGTTCGAGGACGTCTTCCGCGCCAAGGCCGCCTCGGCCCTGGCCCTGCACGAC
CTCACCGAGGACCTGGACCTGGCGGTGTTCGCCCTGTTCTCCTCGTCCTCCGGAGCGGTC
GGCAACGCGGGCCAGGCCAACTACGCCGCCGCCAACGCCTTCCTGGACGCGCTCGCCGAA
CGGCGCCGGGCCCAGGGCCTGGCCGCGACATCCCTCGCCTGGGGTGTATGGGGAGGCGGC
GGAATGGCCGCCGACCAGCGCGCGGCCGACGTGGCCCGGCGCACCGGAATCCGCCCGCTG
GACCCGGACCTCGCCGTCGTGGCGCTGCGCCGGGCCGTCATGGACGGGCGGCCCACCGAG
GTCGTCGCCGACATCGAACGCGACCTGTTCGTCCGCTCCTTCACCGCCGTACGGCCCAGC
CCGCTGCTCGGCGCGCCGACCGTCGACGCCGAGCACCGGGCGGCGGGGGACACCGGCGAG
GACACCACGGGCGACGCGCTGCGCGCGAAGCTGACGGGCCTGCCGCCCGCCAAGCGCTCC
GAGGCCGTACGGGACCTGGTGCGCACCCGGGCCGCGGCCGTACTGGGACACCCCACAGCC
GACGCCGTAGGCGCCGACCGGGCGTTCCGTGACCTCGGCTTCGACTCCCTCAGCGCCGTC
GAACTGCGCAACCAGCTCGGCGCCGCTACCGGACTGAACCTGACCGCCACGCTCGTCTTC
GACCACCCCAACCCCGCCGCCCTGGCAGACCACCTCCTGAGCCTGCTCGTCCCCGACGAG
GACCCGGGGGAGGGGACAGCCGACGACGGCGACCCGGACTCCTCCGCCATCAGGGCCCTG
CTCGCCTCCGTCTCCGTGGCCCAGCTGCGCGAGATCGGCGTGCTCGAACCCCTGCTGAAG
CTCGCCGCCGAGCAGACCGCTGCGTCCGGCGCCGAGGCCGCCGCCGCGACCGCAGCGGAC
GCCTACGACGAGTCGATCGACGCGATGGACATCGCCGACCTGGTGCAGGCGGCATTCGAC
GGCAATTCCCCCCAAGAGCGCTGA
[5] KS34..398
[5] AT561..887
[5] malonyl-CoA754..758
[5] DH935..1097
[5] KR1416..1596
[5] ACP1697..1767
[6] KS1789..2162
[6] AT2318..2636
[6] malonyl-CoA2510..2514
[6] KR2960..3139
[6] ACP3235..3309
[7] KS3331..3703
[7] AT3859..4177
[7] methylmalonyl-CoA4050..4054
[7] KR4487..4666
[7] ACP4767..4837
[8] KS4858..5234
[8] AT5393..5714
[8] malonyl-CoA5586..5590
[8] KR6025..6204
[8] ACP6309..6379
[9] KS6402..6773
[9] AT6914..7219
[9] malonyl-CoA7094..7098
[9] kr7523..7701
[9] ACP7804..7874
[10] KS7902..8273
[10] AT8431..8743
[10] malonyl-CoA8615..8619
[10] KR9061..9240
[10] ACP9343..9413
[5] KS100..1194
[5] AT1681..2661
[5] malonyl-CoA2260..2274
[5] DH2803..3291
[5] KR4246..4788
[5] ACP5089..5301
[6] KS5365..6486
[6] AT6952..7908
[6] malonyl-CoA7528..7542
[6] KR8878..9417
[6] ACP9703..9927
[7] KS9991..11109
[7] AT11575..12531
[7] methylmalonyl-CoA12148..12162
[7] KR13459..13998
[7] ACP14299..14511
[8] KS14572..15702
[8] AT16177..17142
[8] malonyl-CoA16756..16770
[8] KR18073..18612
[8] ACP18925..19137
[9] KS19204..20319
[9] AT20740..21657
[9] malonyl-CoA21280..21294
[9] kr22567..23103
[9] ACP23410..23622
[10] KS23704..24819
[10] AT25291..26229
[10] malonyl-CoA25843..25857
[10] KR27181..27720
[10] ACP28027..28239

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [552-686]  G3DSA:3.40.366.10 [754-848]  G3DSA:3.40.366.10 [2310-2442]  G3DSA:3.40.366.10 [2510-2626]  G3DSA:3.40.366.10 [3850-3982]  G3DSA:3.40.366.10 [4050-4166]  G3DSA:3.40.366.10 [5388-5518]  G3DSA:3.40.366.10 [5586-5702]  G3DSA:3.40.366.10 [6906-7029]  G3DSA:3.40.366.10 [7094-7209]  G3DSA:3.40.366.10 [8419-8550]  G3DSA:3.40.366.10 [8615-8733]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1725-1740]  PS00012 [3267-3282]  PS00012 [4795-4810]  PS00012 [6337-6352]  PS00012 [7832-7847]  PS00012 [9371-9386]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1695-1768]  5.00000000000001e-124 G3DSA:1.10.1200.10 [3240-3313]  5.00000000000001e-124 G3DSA:1.10.1200.10 [4767-4841]  5.00000000000001e-124 G3DSA:1.10.1200.10 [6308-6382]  5.00000000000001e-124 G3DSA:1.10.1200.10 [7802-7877]  5.00000000000001e-124 G3DSA:1.10.1200.10 [9341-9416]  5.00000000000001e-124 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1701-1766]  2.6e-12 PF00550 [3242-3308]  1.5e-08 PF00550 [4770-4836]  1e-08 PF00550 [6312-6378]  1.4e-09 PF00550 [7808-7873]  8.80000000000003e-10 PF00550 [9346-9412]  3.5e-13 PF00550
PF00550   PP-binding
 [1697-1767]  PS50075 [3235-3309]  PS50075 [4767-4837]  PS50075 [6309-6379]  PS50075 [7804-7874]  PS50075 [9343-9413]  PS50075
PS50075   ACP_DOMAIN
 [1690-1805]  1e-28 SSF47336 [3232-3348]  2.60000517657733e-24 SSF47336 [4760-4875]  4.49999046578037e-25 SSF47336 [6302-6418]  9.5000102816722e-28 SSF47336 [7797-7918]  1.39999892049878e-25 SSF47336 [9335-9430]  1.79999754022375e-23 SSF47336
SSF47336   ACP_like
IPR013968 Polyketide synthase, KR (Domain)
 [1416-1594]  4.6e-62 PF08659 [2960-3138]  1.6e-64 PF08659 [4487-4665]  2.59999999999998e-59 PF08659 [6025-6203]  1.39999999999997e-67 PF08659 [7523-7700]  1.3e-31 PF08659 [9061-9239]  1.9e-61 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-272]  7.5e-84 PF00109 [1789-2037]  8.49999999999995e-96 PF00109 [3331-3578]  2.70000000000002e-94 PF00109 [4858-5108]  3.39999999999996e-98 PF00109 [6402-6648]  2.59999999999995e-90 PF00109 [7902-8147]  7.5e-87 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [280-398]  2.70000000000002e-47 PF02801 [2045-2162]  5.30000000000001e-47 PF02801 [3586-3703]  7.5e-47 PF02801 [5116-5234]  1.40000000000001e-45 PF02801 [6658-6773]  2.4e-46 PF02801 [8155-8273]  2.89999999999999e-48 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [561-887]  1.40000000000001e-55 PF00698 [2318-2636]  1.9e-68 PF00698 [3859-4177]  1.39999999999997e-109 PF00698 [5393-5714]  6.20000000000009e-70 PF00698 [6914-7219]  2.50000000000001e-64 PF00698 [8431-8743]  2.50000000000001e-70 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-27]  4.00000000000001e-10 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [558-864]  6.40004254961849e-67 SSF52151 [2314-2621]  2.89997807423186e-69 SSF52151 [3857-4148]  1.79999754022378e-66 SSF52151 [5390-5697]  5.29997329885557e-74 SSF52151 [6909-7211]  3.19999899046355e-72 SSF52151 [8427-8725]  2.50000909916183e-73 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [688-753]  2.19999900980708e-18 SSF55048 [2444-2509]  1.09999909120787e-16 SSF55048 [3985-4049]  1.89999859865864e-16 SSF55048 [5520-5585]  3.00000067992871e-18 SSF55048 [7031-7093]  1.69999922284049e-15 SSF55048 [8552-8614]  3.39999972437717e-17 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [36-284]  G3DSA:3.40.47.10 [285-450]  G3DSA:3.40.47.10 [1789-2048]  G3DSA:3.40.47.10 [2049-2213]  G3DSA:3.40.47.10 [3334-3590]  G3DSA:3.40.47.10 [3591-3757]  G3DSA:3.40.47.10 [4861-5120]  G3DSA:3.40.47.10 [5121-5287]  G3DSA:3.40.47.10 [6404-6660]  G3DSA:3.40.47.10 [6661-6827]  G3DSA:3.40.47.10 [7904-8159]  G3DSA:3.40.47.10 [8160-8323]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [25-396]  5.39997012872478e-97 SSF53901 [1781-2161]  3.699978135861e-101 SSF53901 [3331-3702]  1.90000694315261e-107 SSF53901 [4851-5287]  2.19999900980707e-101 SSF53901 [6394-6826]  9.30000048475962e-103 SSF53901 [7901-8271]  1.50000965748778e-101 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1416-1624]  G3DSA:3.40.50.720 [2959-3141]  G3DSA:3.40.50.720 [4487-4699]  G3DSA:3.40.50.720 [6026-6210]  G3DSA:3.40.50.720 [7522-7704]  G3DSA:3.40.50.720 [9061-9274]  G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [185-201]  PS00606 [1950-1966]  PS00606 [3491-3507]  PS00606 [5021-5037]  PS00606 [6561-6577]  PS00606 [8060-8076]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [562-884]  3.699978135861e-107 SM00827 [2318-2618]  2.0000139277205e-120 SM00827 [3861-4158]  6.40004254961849e-123 SM00827 [5394-5694]  SM00827 [6914-7200]  5.39997012872478e-119 SM00827 [8431-8724]  SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1698-1770]  6.00001679190159e-33 SM00823 [3240-3312]  1e-29 SM00823 [4768-4840]  6.79998707392904e-28 SM00823 [6310-6382]  1.3000049540733e-35 SM00823 [7805-7877]  3.60000433965927e-32 SM00823 [9344-9416]  5.09998762524166e-35 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [935-1097]  4.80002938964646e-91 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-450]  SM00825 [1791-2215]  SM00825 [3334-3756]  SM00825 [4861-5286]  SM00825 [6404-6826]  SM00825 [7904-8325]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1416-1596]  4.50001022902825e-65 SM00822 [2960-3139]  1.60000240695997e-55 SM00822 [4487-4666]  2.69998997787809e-51 SM00822 [6025-6204]  5.89998809405682e-66 SM00822 [7523-7701]  1.09999909120787e-12 SM00822 [9061-9240]  2.80000504261099e-60 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit