close all open/close all

CDS information : Pimar_00080


close this sectionLocation

Organism
StrainATCC 27448 (=NBRC 13367)
Entry namePimaricin
Contig
Start / Stop / Direction51,435 / 50,668 / - [in whole cluster]
44,691 / 43,924 / - [in contig]
Locationcomplement(50668..51435) [in whole cluster]
complement(43924..44691) [in contig]
TypeCDS
Length768 bp (255 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative type II thioesterase
Product (GenBank)PimI protein
Gene
Gene (GenBank)pimI
EC number
Keyword
  • type II thioesterase
Note
Note (GenBank)
Reference
ACC
PmId
[11094342] A complex multienzyme system encoded by five polyketide synthase genes is involved in the biosynthesis of the 26-membered polyene macrolide pimaricin in Streptomyces natalensis. (Chem Biol. , 2000)
Related Reference
ACC
Q6W5Q5
NITE
FR008_00110
PmId
[18836004] Selective removal of aberrant extender units by a type II thioesterase for efficient FR-008/candicidin biosynthesis in Streptomyces sp. strain FR-008. (Appl Environ Microbiol. , 2008)

close this sectionSequence

selected fasta
>putative type II thioesterase [PimI protein]
MTTTTAEGLWARSYHPAPHHRRQLVCFPHAGGSASFFFPVSAQLSSVAEVLSVQYPGRQD
RRTESSPSGIEAMADQVYAALQGRLRSRPTAFFGHSMGAMVAFEVARRLEADGGELTHLF
ASGRRAPSRYRAESVHRRDDDGIVAELKLLSGTDAALLGDEELLRMILPAIRSDYTAVET
YRCDPGAAIKAPITALTGDDDPKTTLEEAEGWRAHTTGAFDLRVYPGGHFFLSSQAQAVL
ALLREHLTAAEEFAV
selected fasta
>putative type II thioesterase [PimI protein]
ATGACGACGACCACGGCGGAAGGGCTCTGGGCCCGGAGCTACCACCCGGCGCCGCACCAT
CGACGCCAGCTCGTCTGCTTTCCGCACGCGGGCGGTTCGGCCTCTTTCTTCTTCCCCGTA
TCGGCACAGCTGTCATCCGTGGCGGAGGTGCTGTCGGTGCAGTACCCCGGCCGCCAGGAC
CGGCGCACCGAGTCCAGCCCCAGCGGCATCGAGGCCATGGCCGACCAGGTGTACGCGGCC
CTGCAAGGCCGGCTCCGGTCGCGGCCGACGGCGTTCTTCGGGCACAGCATGGGCGCGATG
GTCGCCTTCGAGGTGGCCCGGCGGCTGGAGGCCGACGGAGGCGAGCTGACGCACCTCTTC
GCTTCCGGCCGGCGCGCACCCTCGCGCTACCGCGCGGAGAGCGTGCACCGGCGTGACGAC
GACGGGATCGTCGCCGAACTGAAGCTGCTCTCCGGTACGGACGCCGCGCTGCTGGGCGAC
GAGGAGCTGCTGCGCATGATCCTCCCGGCGATCCGCAGCGACTACACCGCGGTGGAGACC
TACCGCTGCGATCCCGGAGCGGCGATCAAGGCGCCGATCACCGCGTTGACCGGTGACGAC
GACCCCAAGACCACGCTGGAGGAGGCCGAGGGGTGGCGCGCGCACACCACGGGGGCGTTC
GACCTCCGGGTCTACCCCGGCGGTCACTTCTTCCTCAGCTCCCAGGCCCAGGCCGTACTG
GCACTGCTGCGGGAACACCTCACCGCCGCCGAGGAGTTCGCCGTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [22-242]  5.89999999999994e-62 PF00975
PF00975   Thioesterase
SignalP
 [1-42]  0.37 Signal
Bacteria, Gram-negative   
TMHMM No significant hit