close all open/close all

CDS information : Pimar_00090


close this sectionLocation

Organism
StrainATCC 27448 (=NBRC 13367)
Entry namePimaricin
Contig
Start / Stop / Direction52,684 / 51,653 / - [in whole cluster]
45,940 / 44,909 / - [in contig]
Locationcomplement(51653..52684) [in whole cluster]
complement(44909..45940) [in contig]
TypeCDS
Length1,032 bp (343 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative GDP-mannose 4,6-dehydratase
putative GDP-D-mannose dehydratase
Product (GenBank)PimJ protein
GenepimJ
gmd
Gene (GenBank)pimJ
EC number4.2.1.47
Keyword
  • mycosamine
Note
Note (GenBank)
Reference
ACC
PmId
[11094342] A complex multienzyme system encoded by five polyketide synthase genes is involved in the biosynthesis of the 26-membered polyene macrolide pimaricin in Streptomyces natalensis. (Chem Biol. , 2000)
Related Reference
ACC
Q9L4X4
NITE
Nysta_00040
PmId
[17905880] Analysis of the mycosamine biosynthesis and attachment genes in the nystatin biosynthetic gene cluster of Streptomyces noursei ATCC 11455. (Appl Environ Microbiol. , 2007)
ACC
Q6T1X7
PmId
[11096116] Identification of two GDP-6-deoxy-D-lyxo-4-hexulose reductases synthesizing GDP-D-rhamnose in Aneurinibacillus thermoaerophilus L420-91T. (J Biol Chem. , 2001)
ACC
P93031
PmId
[9050909] The MUR1 gene of Arabidopsis thaliana encodes an isoform of GDP-D-mannose-4,6-dehydratase, catalyzing the first step in the de novo synthesis of GDP-L-fucose. (Proc Natl Acad Sci U S A. , 1997)
[12881408] Interaction of GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase with GDP-mannose-4,6-dehydratase stabilizes the enzyme activity for formation of GDP-fucose from GDP-mannose. (Glycobiology. , 2003)

close this sectionSequence

selected fasta
>putative GDP-mannose 4,6-dehydratase [PimJ protein]
MSKRALITGITGQDGSYLAEHLLAQGYQVWGLIRGQANPRKSRVSRLVSELSFVDGDLMD
QSSLCSAVDKVQPDEIYNLGAISFVPMSWQQPELVTEINGMGVLRMLEAIRMVSGLNGSR
SDGGGQIRFYQASSSEMFGKVAETPQRETTIFRPRSPYGVAKTYGHFITRNYRESFGMYA
VSGMLFNHESPRRGAEFVTRKISLAVARIKLGYQDKLSLGNLDAVRDWGFAGDYVRAMHL
MLQQDEPGDYVIGTGEMHSVRDAVRIAFEHVGLNWEDYVSIDPSLVRPAEVEILCADAER
ARTQLGWEPSVDFPELMRMMVDSDLRQASREREYGDLLLAASW
selected fasta
>putative GDP-mannose 4,6-dehydratase [PimJ protein]
ATGTCCAAGCGTGCGCTGATCACCGGAATCACCGGGCAGGACGGCTCCTATCTGGCCGAG
CACCTGCTCGCCCAGGGGTACCAGGTATGGGGTCTGATACGAGGTCAGGCGAACCCCAGG
AAGTCGAGGGTCAGCCGGCTGGTGTCCGAACTGTCCTTCGTCGACGGCGACTTGATGGAC
CAGTCCAGCCTGTGCTCCGCCGTCGACAAGGTGCAGCCCGACGAGATCTACAACCTCGGT
GCGATCTCCTTCGTACCGATGTCCTGGCAGCAGCCCGAACTCGTCACCGAGATCAACGGC
ATGGGCGTCCTGCGCATGCTGGAGGCGATCCGCATGGTCAGCGGGCTGAACGGCTCCCGG
AGTGACGGCGGCGGCCAGATCCGGTTCTACCAGGCGTCCTCGTCGGAGATGTTCGGCAAG
GTCGCCGAGACCCCGCAGCGCGAGACCACGATCTTCCGCCCGCGCAGCCCCTACGGCGTG
GCGAAGACCTACGGGCACTTCATCACCCGCAACTACCGTGAGTCGTTCGGTATGTACGCG
GTCTCCGGGATGCTGTTCAACCACGAATCCCCGCGCCGTGGTGCGGAGTTCGTGACCCGG
AAGATCTCCCTCGCGGTGGCCCGTATCAAGCTCGGCTACCAGGACAAGCTGTCCCTGGGA
AACCTCGACGCCGTACGCGACTGGGGCTTCGCCGGCGACTACGTCCGTGCCATGCATCTG
ATGCTGCAACAGGACGAGCCGGGCGACTATGTGATCGGGACCGGCGAGATGCACTCGGTC
CGCGACGCCGTCCGCATCGCCTTCGAGCATGTGGGCCTGAACTGGGAGGACTACGTCAGC
ATCGACCCCTCGCTGGTGCGCCCGGCCGAGGTGGAGATCCTGTGCGCGGACGCCGAGCGC
GCCCGCACCCAGCTGGGCTGGGAGCCCAGCGTCGACTTCCCCGAACTGATGCGCATGATG
GTCGACTCCGACCTGCGCCAGGCATCCCGCGAGCGGGAGTACGGGGACCTGCTGCTGGCG
GCCAGCTGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [5-253]  5.40000000000002e-62 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [2-191]  1.5e-44 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit