close all open/close all

CDS information : Pimar_00100


close this sectionLocation

Organism
StrainATCC 27448 (=NBRC 13367)
Entry namePimaricin
Contig
Start / Stop / Direction53,027 / 54,835 / + [in whole cluster]
46,283 / 48,091 / + [in contig]
Location53027..54835 [in whole cluster]
46283..48091 [in contig]
TypeCDS
Length1,809 bp (602 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative ABC transporter ATP-binding/permease protein
Product (GenBank)PimA protein
Gene
Gene (GenBank)pimA
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11094342] A complex multienzyme system encoded by five polyketide synthase genes is involved in the biosynthesis of the 26-membered polyene macrolide pimaricin in Streptomyces natalensis. (Chem Biol. , 2000)
Related Reference
ACC
Q9L4X5
NITE
Nysta_00030
PmId
[16251298] Nystatin biosynthesis and transport: nysH and nysG genes encoding a putative ABC transporter system in Streptomyces noursei ATCC 11455 are required for efficient conversion of 10-deoxynystatin to nystatin. (Antimicrob Agents Chemother. , 2005)

close this sectionSequence

selected fasta
>putative ABC transporter ATP-binding/permease protein [PimA protein]
MLLCLLRIHLRPHRRSVALLGLLQLVQILATLALPTLGAAVIDNGVVRADSGYITRTGLA
MLAVALVQIAASVAAVALGARTAMAMGRDLRSAVFRRVLDFSAREVGRFGTPSLMTRTVN
DVQQVQVLALSAFGVVVSAPLMCLGSIALALQQDVPLSLLLVALMVAVGMSFGLILGRTD
PFYARMQKQLDRINGLLRERITGVRVVRAFVRDAHEGARFGRTNSELRDISLRVGRLLAT
VIPLVLLVLNAFMAAVVWFGAHRIDAGAMRFGALSAFLSYLTLITMSVVMVTFVCLPMPR
ARVSAERIQQVLATEPSVAAPSEPYARCPQPGQLSLYGAGFRYPGAKEPVLHGIDLSVRP
GETVAILGSTGSGKTTLLNLVLRHFDATDGAVHVGGVDVRTLDAAVLRRTVGFVPQRPYL
FSGTVASNLRFGDPDATDDELWHALEIAQARDFVRLLPGGLNAPLTQGGTNVSGGQRQRL
AIARTLLRRPDIYLFDDCFSALDHATDAALRAALEPEISRATVVTVAQRVSTVRRAGRIV
VLDAGRVAATGTHEELLRTSTTYREIARSQLTAITGDHDGTGTDAAAATTLQEAVHGLDG
QL
selected fasta
>putative ABC transporter ATP-binding/permease protein [PimA protein]
GTGCTGCTATGTCTTCTGCGAATCCATCTGCGGCCGCACCGGCGCTCCGTCGCCCTGCTG
GGGCTTTTGCAACTGGTGCAGATCCTGGCCACTTTGGCCCTGCCGACACTGGGCGCCGCG
GTCATCGACAACGGCGTGGTCAGGGCCGACAGCGGCTACATCACCCGGACCGGCCTGGCC
ATGCTGGCCGTGGCGCTCGTGCAGATCGCGGCGTCCGTGGCCGCGGTGGCGCTGGGCGCC
CGTACGGCCATGGCGATGGGCCGCGACCTGCGCTCGGCCGTCTTCCGCCGGGTGCTGGAC
TTCTCGGCCCGCGAGGTCGGGCGGTTCGGCACTCCGTCGCTGATGACGCGGACCGTCAAC
GATGTGCAGCAGGTGCAGGTGCTGGCCCTGTCCGCGTTCGGCGTCGTCGTGTCGGCGCCC
CTGATGTGTCTGGGCAGCATCGCGCTCGCACTCCAGCAGGACGTCCCGCTCTCCCTGCTC
CTGGTGGCGCTGATGGTGGCCGTCGGAATGTCCTTCGGCCTCATTCTCGGCCGCACCGAT
CCGTTCTACGCCCGTATGCAGAAACAGCTGGACCGCATCAACGGGCTGCTGCGCGAACGC
ATTACCGGAGTCCGCGTCGTACGGGCTTTTGTGCGCGACGCCCACGAAGGCGCGAGATTC
GGCCGCACCAATTCCGAATTGCGTGACATCTCGCTGCGCGTCGGCCGGCTGCTGGCCACG
GTCATCCCCCTGGTGCTGCTGGTCCTCAACGCCTTCATGGCAGCCGTGGTGTGGTTCGGC
GCCCACCGCATCGACGCCGGGGCGATGCGGTTCGGTGCGCTCAGCGCGTTTCTGAGCTAC
CTGACGCTGATCACGATGTCGGTGGTGATGGTGACCTTCGTGTGCCTGCCGATGCCGCGG
GCGAGGGTTTCGGCCGAGCGGATCCAGCAGGTGCTGGCGACCGAGCCGAGCGTGGCGGCG
CCGAGTGAGCCGTACGCGCGCTGCCCGCAGCCGGGCCAGCTGTCCTTGTACGGAGCCGGG
TTCCGCTATCCGGGAGCGAAGGAGCCGGTGCTGCACGGCATCGATCTGAGCGTCCGGCCC
GGCGAGACGGTGGCGATCCTCGGCAGCACCGGCAGCGGCAAGACCACCCTGCTCAACCTC
GTGCTGCGGCACTTCGACGCCACCGACGGCGCCGTCCACGTGGGCGGCGTCGATGTCCGC
ACCCTGGACGCGGCGGTGCTGCGCCGCACCGTCGGCTTCGTACCGCAGCGGCCGTACCTC
TTCTCCGGCACCGTCGCGAGCAATCTGCGCTTCGGCGACCCGGACGCCACCGACGACGAA
CTCTGGCACGCGCTGGAGATCGCCCAGGCGCGCGATTTCGTGCGGCTCCTGCCCGGCGGG
CTGAACGCACCCCTCACCCAGGGCGGCACCAATGTGTCGGGCGGGCAACGGCAGCGCCTG
GCGATCGCCCGCACCCTGCTGCGCAGGCCGGACATCTATCTCTTCGACGACTGCTTCTCC
GCGCTGGACCACGCCACGGACGCCGCGCTGCGGGCCGCCCTGGAGCCGGAGATCTCCCGG
GCGACGGTGGTCACCGTCGCCCAGCGCGTCAGCACCGTCCGCCGCGCGGGGCGCATCGTC
GTCCTGGACGCGGGGCGGGTGGCCGCCACCGGAACGCACGAGGAGCTGCTGCGCACCAGT
ACGACGTACCGGGAGATCGCCCGGTCCCAGCTCACCGCGATCACCGGTGACCACGACGGC
ACCGGCACGGACGCCGCAGCCGCCACGACCCTTCAGGAGGCTGTCCATGGTCTCGACGGA
CAGCTCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001140 ABC transporter, transmembrane domain (Domain)
 [19-288]  4.70000000000001e-32 PF00664
PF00664   ABC_membrane
IPR003439 ABC transporter-like (Domain)
 [375-499]  5.80000000000004e-18 PF00005
PF00005   ABC_tran
 [334-569]  PS50893
PS50893   ABC_TRANSPORTER_2
IPR003593 AAA+ ATPase domain (Domain)
 [360-546]  5.8999880940569e-18 SM00382
SM00382   AAA
IPR011527 ABC transporter, transmembrane domain, type 1 (Domain)
 [6-316]  2.99998750445706e-60 SSF90123
SSF90123   ABC_TM_1
IPR017871 ABC transporter, conserved site (Conserved_site)
 [472-486]  PS00211
PS00211   ABC_TRANSPORTER_1
IPR017940 ABC transporter, integral membrane type 1 (Domain)
 [18-294]  PS50929
PS50929   ABC_TM1F
SignalP
 [1-39]  0.993 Signal
Bacteria, Gram-positive   
 [1-33]  0.729 Signal
Eukaryota   
 [1-33]  0.663 Signal
Bacteria, Gram-negative   
TMHMM
 [20-42]  Transmembrane (i-o) [57-79]  Transmembrane (o-i) [127-149]  Transmembrane (i-o) [155-177]  Transmembrane (o-i) [237-259]  Transmembrane (i-o) [274-296]  Transmembrane (o-i)
Transmembrane 6