close all open/close all

CDS information : Pimar_00110


close this sectionLocation

Organism
StrainATCC 27448 (=NBRC 13367)
Entry namePimaricin
Contig
Start / Stop / Direction54,813 / 56,693 / + [in whole cluster]
48,069 / 49,949 / + [in contig]
Location54813..56693 [in whole cluster]
48069..49949 [in contig]
TypeCDS
Length1,881 bp (626 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative ABC transporter ATP-binding/permease protein
Product (GenBank)PimB protein
Gene
Gene (GenBank)pimB
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11094342] A complex multienzyme system encoded by five polyketide synthase genes is involved in the biosynthesis of the 26-membered polyene macrolide pimaricin in Streptomyces natalensis. (Chem Biol. , 2000)
Related Reference
ACC
Q9L4X6
NITE
Nysta_00020
PmId
[16251298] Nystatin biosynthesis and transport: nysH and nysG genes encoding a putative ABC transporter system in Streptomyces noursei ATCC 11455 are required for efficient conversion of 10-deoxynystatin to nystatin. (Antimicrob Agents Chemother. , 2005)

close this sectionSequence

selected fasta
>putative ABC transporter ATP-binding/permease protein [PimB protein]
MVSTDSSSHEWRGPARRTLELLRPHRAPVTVAVALGIGGVVLNASGPMLLGRATDLIFDG
IRHTHGSRGIDFDAIARVLLTALALFAAASLLTLLQGRLVTAVVQRVVFALRRSVEAKLA
RLPLRYFDRHPAGEVLSRVTNDVDNLQQTLQQTLSQLITAAFSVLTMVVLMFALSPPLAL
IMLACVPVSAVIAARISRRAQPRFTQQWSATGALSAHVEEVYTGHALVKGFGRREQAERV
FDEHNDALYRAGARAQCVSGAIEPSMMFVSNLGYVVVAVVGALRVVSGALTIGDVQAFIL
YSRQFSQPIVEVAGIAARLQSALASAKRVHDLLDADEQGPDPERPARLPQARGHVRFDKV
GFRYSPDLPLIEDLCLTVEPGQTVAVVGPTGAGKTTLGNLLMRFYETDAGRILLDGTDIT
TLTREDLRSHIGLVLQDAWLFSGTIAENIAYGRPDATREEIVAAARATCADRFIRTLPDG
YDTVLDEESANVSAGEKQLITIARAFLARPSILLLDEATSSVDTRTEVLIQRAMHSLRAG
RTSFVIAHRLSTIRDADLILVMEDGRIVERGTHDQLLAAEGAYARLHATAGPDATAGPDA
TAGPDATAGPDATAAPRTSGISPSLS
selected fasta
>putative ABC transporter ATP-binding/permease protein [PimB protein]
ATGGTCTCGACGGACAGCTCTAGCCACGAGTGGCGCGGCCCGGCCCGCCGCACGCTGGAA
CTGCTGCGCCCGCACCGTGCCCCGGTGACCGTGGCGGTCGCCCTCGGCATCGGCGGCGTC
GTCCTCAACGCGTCGGGTCCGATGCTCCTCGGCAGGGCCACGGACCTCATCTTCGACGGC
ATCCGGCACACCCACGGATCCAGAGGCATCGACTTCGACGCGATCGCCCGTGTGCTGCTG
ACGGCGCTCGCGCTCTTCGCCGCCGCCTCCCTCCTCACCCTCCTCCAGGGGCGGCTGGTC
ACGGCCGTCGTCCAGCGTGTGGTCTTCGCACTGCGCCGTTCCGTGGAGGCCAAGCTCGCC
CGCCTGCCGCTGCGGTACTTCGACCGCCACCCGGCGGGGGAGGTGCTCAGCCGGGTGACC
AATGACGTCGACAACCTCCAGCAGACCCTCCAGCAGACCCTCAGCCAGCTGATCACGGCG
GCGTTCTCCGTGCTGACCATGGTGGTGCTGATGTTCGCCCTCTCGCCGCCGCTGGCCCTG
ATCATGCTGGCCTGCGTACCGGTGTCGGCCGTGATCGCGGCCCGGATCAGCCGGCGCGCA
CAGCCGCGGTTCACCCAGCAGTGGTCCGCGACCGGAGCGCTCAGCGCCCATGTCGAGGAG
GTCTACACCGGACATGCGCTGGTCAAGGGCTTCGGGCGGCGCGAGCAGGCCGAGCGGGTC
TTCGACGAGCACAACGACGCCCTGTACCGCGCCGGTGCGAGGGCCCAGTGCGTCTCCGGC
GCCATCGAACCGTCGATGATGTTCGTCTCCAACCTCGGCTATGTCGTCGTGGCGGTCGTC
GGCGCGCTGCGCGTGGTCTCCGGGGCCCTGACCATCGGCGACGTCCAGGCGTTCATCCTC
TACTCCCGGCAGTTCAGTCAGCCGATCGTCGAGGTCGCCGGCATCGCCGCCCGCCTCCAG
TCCGCCCTCGCCTCCGCGAAGCGGGTCCACGACCTCCTGGACGCCGACGAACAAGGCCCC
GACCCCGAGCGGCCCGCACGCCTCCCACAGGCCCGTGGACACGTCCGGTTCGACAAGGTC
GGTTTCCGCTACTCCCCCGACCTCCCCCTCATCGAGGACCTCTGCCTCACCGTCGAACCC
GGACAGACCGTGGCGGTCGTCGGTCCGACCGGCGCGGGCAAGACCACGCTGGGCAACCTC
CTCATGCGGTTCTACGAAACCGACGCGGGGCGCATCCTCCTGGACGGCACCGACATCACC
ACCCTGACCCGCGAGGACCTGCGCTCCCATATCGGCCTGGTGCTCCAGGACGCCTGGCTG
TTCTCCGGCACCATCGCCGAGAACATCGCCTACGGGCGCCCCGACGCGACGCGCGAGGAG
ATCGTGGCCGCCGCCCGCGCCACCTGCGCCGACCGCTTCATCCGCACCCTGCCGGACGGC
TACGACACCGTCCTGGACGAGGAGTCGGCCAACGTCAGCGCGGGCGAGAAGCAGCTCATC
ACCATTGCCCGGGCCTTCCTGGCCCGGCCCTCGATCCTGCTCCTGGACGAGGCGACCAGC
TCCGTCGACACCCGCACGGAAGTCCTCATCCAACGCGCGATGCACTCGCTGCGCGCGGGC
CGCACCAGCTTCGTCATAGCCCACCGGCTGTCCACCATCCGCGATGCGGACCTCATCCTC
GTCATGGAAGACGGCCGCATCGTCGAGCGCGGCACCCACGACCAGCTCCTGGCCGCCGAG
GGGGCCTACGCCCGGCTGCATGCGACCGCGGGGCCCGATGCGACGGCGGGGCCCGATGCG
ACGGCGGGGCCCGATGCGACGGCGGGGCCCGATGCGACGGCGGCGCCGCGTACCTCTGGC
ATTTCCCCCAGTCTTTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001140 ABC transporter, transmembrane domain (Domain)
 [31-308]  9.29999999999998e-51 PF00664
PF00664   ABC_membrane
IPR003439 ABC transporter-like (Domain)
 [395-520]  9.50000000000001e-19 PF00005
PF00005   ABC_tran
 [355-589]  PS50893
PS50893   ABC_TRANSPORTER_2
IPR003593 AAA+ ATPase domain (Domain)
 [380-572]  4.40000933643891e-18 SM00382
SM00382   AAA
IPR011527 ABC transporter, transmembrane domain, type 1 (Domain)
 [11-345]  2.59998233910302e-80 SSF90123
SSF90123   ABC_TM_1
IPR017871 ABC transporter, conserved site (Conserved_site)
 [492-506]  PS00211
PS00211   ABC_TRANSPORTER_1
IPR017940 ABC transporter, integral membrane type 1 (Domain)
 [31-321]  PS50929
PS50929   ABC_TM1F
SignalP
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [31-53]  Transmembrane (o-i) [74-96]  Transmembrane (i-o) [172-194]  Transmembrane (o-i) [271-293]  Transmembrane (i-o)
Transmembrane 4