close all open/close all

CDS information : Pimar_00120


close this sectionLocation

Organism
StrainATCC 27448 (=NBRC 13367)
Entry namePimaricin
Contig
Start / Stop / Direction56,708 / 58,357 / + [in whole cluster]
49,964 / 51,613 / + [in contig]
Location56708..58357 [in whole cluster]
49964..51613 [in contig]
TypeCDS
Length1,650 bp (549 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
Productcholesterol oxidase
Product (GenBank)PimE protein
Gene
Gene (GenBank)pimE
EC number1.1.3.6
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11094342] A complex multienzyme system encoded by five polyketide synthase genes is involved in the biosynthesis of the 26-membered polyene macrolide pimaricin in Streptomyces natalensis. (Chem Biol. , 2000)
[17379143] Cholesterol oxidases act as signaling proteins for the biosynthesis of the polyene macrolide pimaricin. (Chem Biol. , 2007)
Related Reference
ACC
P12676
PmId
[10194345] Crystal structure determination of cholesterol oxidase from Streptomyces and structural characterization of key active site mutants. (Biochemistry. , 1999)
PmId
[26502732] Improvement of Natamycin Production by Cholesterol Oxidase Overexpression in Streptomyces gilvosporeus. (J Microbiol Biotechnol. , 2016)

close this sectionSequence

selected fasta
>cholesterol oxidase [PimE protein]
MFENQHLSRRRLLGLAALGGAAAAGMTTITSAPHAAAADRRSPQARSGSFVPAVVIGTGY
GAAVSALRLGEAGIPTLMLEMGQLWNKPADDGNVFCGMLSPDRRSSWFKSRTEAPLGSFL
WLDVINRDIDPYAGVLDKVHFDQMSVYVGRGVGGGSLVNGGMAVVPKRSYFEEVLPRVDA
AEMYDRYFPRANSMLKVNHIDKGWFEETEWYKFARVSREQAGKAGLGTTFVPNVYDFDYM
RREANGESPKSALATEVIYGNNHGKQSLDKTYLAAALGTGKVTIETLHQVRAIHQQPDGS
YVLSVDQIDTAGQTVAHKEISCRHLFLGAGSLGSTELLVRARDTGALPDLNAEVGAGWGP
NGNIMTGRANHVWNPTGAHQSSIPALGIDDWNNPTAPVFAEIAPMPAGLETWVSLYLAIT
KNPERGTFVYDKATDRAALRWTRDQNTPAVNAARSLFDRINKANGTMYRYDLFGPQLKNF
SDDFCYHPLGGCVLGKATDGYGRVAGYHNLYVTDGALIPGSIGVNPFVTITALAERNIER
IIAEDVKAA
selected fasta
>cholesterol oxidase [PimE protein]
ATGTTCGAGAACCAGCATCTGTCACGGCGCCGTCTGCTCGGACTGGCCGCCCTCGGCGGC
GCCGCAGCCGCCGGAATGACCACGATCACCTCCGCCCCTCATGCCGCGGCCGCCGACCGG
CGCAGTCCGCAGGCCCGCAGCGGCTCGTTCGTACCGGCCGTGGTGATCGGTACGGGATAC
GGCGCCGCGGTCTCCGCGCTGCGGCTCGGCGAGGCCGGAATTCCCACGCTCATGCTCGAA
ATGGGCCAGCTGTGGAACAAGCCCGCCGACGACGGCAACGTCTTCTGCGGAATGCTCTCG
CCCGACCGCCGCTCCAGCTGGTTCAAGTCCCGCACCGAGGCCCCGCTCGGCTCGTTCCTG
TGGCTGGATGTGATCAACCGCGACATCGACCCGTACGCGGGAGTGCTGGACAAGGTGCAC
TTCGACCAGATGTCGGTGTACGTGGGGCGGGGTGTCGGCGGCGGCTCGCTGGTCAACGGC
GGGATGGCCGTCGTACCGAAGCGCTCGTACTTCGAGGAGGTCCTCCCGCGGGTGGACGCC
GCCGAGATGTACGACCGGTACTTCCCGCGCGCCAACTCCATGCTCAAGGTGAACCACATC
GACAAGGGGTGGTTCGAGGAGACGGAGTGGTACAAGTTCGCGCGGGTCTCGCGCGAGCAG
GCGGGCAAGGCGGGCCTGGGCACCACCTTCGTCCCCAACGTCTACGACTTCGACTACATG
CGGCGCGAGGCGAACGGTGAGTCGCCCAAGTCCGCGCTGGCGACCGAGGTCATCTACGGC
AACAACCACGGCAAACAGAGCCTGGACAAGACCTACCTGGCCGCCGCGCTCGGCACCGGC
AAGGTCACCATCGAGACCCTGCACCAGGTCAGGGCGATCCACCAGCAGCCGGACGGCAGC
TACGTGCTGTCCGTGGACCAGATCGACACGGCCGGCCAGACCGTCGCCCACAAGGAGATC
TCCTGCCGTCACCTGTTCCTCGGCGCCGGCAGCCTCGGCTCCACCGAACTGCTGGTGCGC
GCCCGGGACACCGGCGCGCTGCCCGACCTCAACGCCGAGGTCGGCGCGGGCTGGGGCCCC
AACGGCAACATCATGACCGGCCGGGCCAACCACGTCTGGAACCCCACCGGGGCCCACCAG
TCCTCGATCCCCGCTCTGGGCATCGACGACTGGAACAACCCCACCGCCCCGGTCTTCGCC
GAAATCGCCCCGATGCCCGCCGGGTTGGAGACCTGGGTCAGCCTCTATCTGGCGATCACC
AAGAACCCCGAGCGCGGCACCTTCGTCTACGACAAGGCCACCGACCGGGCCGCGCTGCGC
TGGACGCGGGACCAGAACACGCCCGCGGTCAACGCCGCCAGGTCGCTCTTCGACCGCATC
AACAAGGCCAACGGCACGATGTACCGCTACGACCTGTTCGGGCCGCAGCTGAAGAACTTC
TCCGACGACTTCTGCTACCACCCGCTCGGCGGCTGCGTCCTGGGCAAGGCCACCGACGGG
TACGGCCGGGTCGCCGGCTACCACAACCTCTACGTCACGGACGGCGCGCTCATCCCGGGG
TCCATCGGGGTCAACCCCTTCGTGACCATCACGGCGCTGGCCGAGCGGAACATCGAGCGG
ATCATCGCGGAGGACGTCAAGGCCGCCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000172 Glucose-methanol-choline oxidoreductase, N-terminal (Domain)
 [145-340]  6.59999999999999e-07 PF00732
PF00732   GMC_oxred_N
 [149-172]  PS00623
PS00623   GMC_OXRED_1
IPR006311 Twin-arginine translocation pathway, signal sequence (Conserved_site)
 [1-38]  PS51318
PS51318   TAT
IPR007867 Glucose-methanol-choline oxidoreductase, C-terminal (Domain)
 [480-536]  5.40000000000001e-13 PF05199
PF05199   GMC_oxred_C
SignalP
 [1-35]  1 Signal
Bacteria, Gram-negative   
 [1-37]  1 Signal
Bacteria, Gram-positive   
 [1-24]  0.945 Signal
Eukaryota   
TMHMM
 [12-34]  Transmembrane (i-o)
Transmembrane 1