close all open/close all

CDS information : Pimar_00130


close this sectionLocation

Organism
StrainATCC 27448 (=NBRC 13367)
Entry namePimaricin
Contig
Start / Stop / Direction58,446 / 59,504 / + [in whole cluster]
51,702 / 52,760 / + [in contig]
Location58446..59504 [in whole cluster]
51702..52760 [in contig]
TypeCDS
Length1,059 bp (352 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative GDP-3-keto-6-deoxy-D-mannose C-3 aminotransferase
Product (GenBank)PimC protein
Gene
Gene (GenBank)pimC
EC number2.6.1.-
Keyword
  • mycosamine
Note
Note (GenBank)
Reference
ACC
PmId
[11094342] A complex multienzyme system encoded by five polyketide synthase genes is involved in the biosynthesis of the 26-membered polyene macrolide pimaricin in Streptomyces natalensis. (Chem Biol. , 2000)
Related Reference
ACC
Q93NX0
NITE
Amph_00130
PmId
[16079135] Biosynthesis of amphotericin derivatives lacking exocyclic carboxyl groups. (J Biol Chem. , 2005)
ACC
Q6W5Q8
NITE
FR008_00080
PmId
[14652074] Organizational and mutational analysis of a complete FR-008/candicidin gene cluster encoding a structurally related polyene complex. (Chem Biol. , 2003)

close this sectionSequence

selected fasta
>putative GDP-3-keto-6-deoxy-D-mannose C-3 aminotransferase [PimC protein]
MSFKYPVSRPTLDGRELEYVTGAVGDGWISSQGPMVARFERAFADYNGVAHGVSCSSGTA
ALTLALRALGIGPGDEVIVPEFTMVASAWAVTYTGATPVFVDCGDDLNIDVTRIEEKITA
RTKAVMPVHIYGRRCDMDAVMDIAHQYNLRVVEDSAEAHGVRPVGDIACYSLFANKIITA
GEGGICLTDDPRLAGQLAHLRAMAFTKDHSFLHKKVAYNFRMTAMQAAVALAQVERLDDI
LATRREIERRYDEGLAGVPGITLMPPRDVLWMYDLRAERREELREFLAGESIETRLFFKP
MSRQPMYFHPDWPSLKAHTFAEDGLYLPTHTGLSATDQDFVIDRVRAFYGAS
selected fasta
>putative GDP-3-keto-6-deoxy-D-mannose C-3 aminotransferase [PimC protein]
ATGTCGTTCAAGTACCCCGTGTCCAGGCCCACTCTGGACGGCCGGGAGCTGGAGTATGTG
ACCGGTGCCGTCGGGGACGGCTGGATCTCGTCCCAGGGCCCGATGGTCGCGCGGTTCGAG
CGTGCCTTCGCGGACTACAACGGCGTCGCGCACGGCGTGTCCTGTTCGTCCGGGACGGCG
GCGCTCACGCTGGCGCTGCGGGCGCTGGGTATCGGCCCGGGGGACGAGGTGATCGTTCCG
GAGTTCACGATGGTCGCCTCGGCATGGGCGGTCACCTACACCGGTGCGACGCCCGTGTTC
GTGGACTGCGGAGACGACCTCAATATCGATGTCACGCGTATCGAGGAGAAGATCACGGCG
CGGACGAAGGCCGTGATGCCCGTCCACATCTATGGGCGGCGGTGCGATATGGACGCCGTG
ATGGATATCGCGCACCAGTACAACCTGCGGGTCGTGGAGGACAGTGCCGAGGCCCACGGT
GTCCGCCCGGTCGGGGACATCGCGTGCTACTCGCTGTTCGCCAACAAAATCATCACGGCG
GGCGAGGGCGGCATCTGCCTCACCGACGACCCCAGGCTGGCCGGGCAGCTGGCGCATCTG
CGCGCCATGGCGTTCACCAAGGACCACAGTTTCCTGCACAAGAAGGTCGCCTACAACTTC
CGGATGACGGCGATGCAGGCCGCCGTCGCGCTCGCCCAGGTCGAGCGGCTGGACGACATC
CTCGCCACGCGGCGGGAGATCGAGCGGCGCTATGACGAGGGGCTCGCCGGAGTTCCCGGT
ATCACGCTGATGCCGCCGCGGGACGTGCTGTGGATGTACGACCTGCGGGCCGAACGCCGC
GAGGAGCTACGGGAGTTCCTGGCCGGTGAGTCGATCGAGACCCGGCTGTTCTTCAAGCCG
ATGAGCCGGCAGCCCATGTACTTCCACCCCGACTGGCCCTCGCTCAAGGCGCATACGTTC
GCCGAGGACGGGCTGTATCTGCCCACCCACACCGGACTGTCCGCCACCGACCAGGACTTC
GTGATCGACCGGGTCCGCGCGTTCTACGGCGCGAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000653 DegT/DnrJ/EryC1/StrS aminotransferase (Family)
 [1-351]  2.39999798157263e-93 PIRSF000390
PIRSF000390   PLP_StrS
 [12-346]  4.80000000000003e-102 PF01041
PF01041   DegT_DnrJ_EryC1
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [4-236]  2.79999999999994e-78 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [237-350]  2.4e-20 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [2-352]  1.3000049540733e-101 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit