close all open/close all

CDS information : Pimar_00140


close this sectionLocation

Organism
StrainATCC 27448 (=NBRC 13367)
Entry namePimaricin
Contig
Start / Stop / Direction59,533 / 60,729 / + [in whole cluster]
52,789 / 53,985 / + [in contig]
Location59533..60729 [in whole cluster]
52789..53985 [in contig]
TypeCDS
Length1,197 bp (398 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)PimG protein
Gene
Gene (GenBank)pimG
EC number
Keyword
  • C-12 carboxy group formation
Note
Note (GenBank)
Reference
ACC
PmId
[11094342] A complex multienzyme system encoded by five polyketide synthase genes is involved in the biosynthesis of the 26-membered polyene macrolide pimaricin in Streptomyces natalensis. (Chem Biol. , 2000)
Related Reference
ACC
Q6T2C1
NITE
Rimoc_00060
PmId
[16242652] A tailoring activity is responsible for generating polyene amide derivatives in Streptomyces diastaticus var. 108. (Chem Biol. , 2005)
ACC
Q6W5Q7
NITE
FR008_00090
PmId
[19139241] Tailoring the P450 monooxygenase gene for FR-008/candicidin biosynthesis. (Appl Environ Microbiol. , 2009)
ACC
Q9L4W8
NITE
Nysta_00100
PmId
[21764946] New nystatin-related antifungal polyene macrolides with altered polyol region generated via biosynthetic engineering of Streptomyces noursei. (Appl Environ Microbiol. , 2011)
ACC
F1CLB6
PmId
[25952111] Engineered biosynthesis of pimaricin derivatives with improved antifungal activity and reduced cytotoxicity. (Appl Microbiol Biotechnol. , 2015)

close this sectionSequence

selected fasta
>putative cytochrome P450 [PimG protein]
MTYTDPAAPETDPPAVDFPQRKPGVPFPPPDYADYRDRKGLVLSQLSDGKRVWLVTRHED
VRAVLTSPSISSNPEHKGFPNVGNLGVPKQDQIPGWFVGMDSPEHDRFRKALIPEFTVRR
VRAMKPAIERTVDAQLDAMLAAGNTADLVADFALPIPSLVISALLGVPPADREFFESRTR
VLVSLRSSTDDDRMAAAKDLLRYINRLVEIKQKWGGDDLITRLLATGAIAPHEMSGVLML
LLIAGHETTANNIALGVVTLLANPQWIGDDRAVEETLRFHSVADLVSLRVAVQDVEIAGQ
LIKAGEGIVPLVAAANHDENAFECPHAFDPSRSARHHVAFGYGVHQCLGQNLVRIEMEVA
YRKLFERIPNLELAVPTDGLDIKYDGVLYGLNELPVRW
selected fasta
>putative cytochrome P450 [PimG protein]
ATGACGTACACAGACCCGGCCGCGCCCGAGACGGATCCGCCGGCCGTCGACTTTCCGCAG
CGCAAGCCCGGCGTGCCGTTCCCGCCGCCCGACTACGCCGACTACCGCGACCGGAAGGGG
CTCGTCCTCTCGCAGCTGTCCGACGGCAAACGGGTATGGCTGGTCACCCGGCACGAGGAC
GTACGCGCCGTACTGACCAGCCCGAGCATCAGCTCGAACCCCGAGCACAAGGGATTTCCC
AACGTCGGGAACCTGGGTGTGCCCAAGCAGGACCAGATCCCGGGCTGGTTCGTGGGCATG
GACTCCCCCGAGCACGACCGGTTCCGCAAGGCCCTCATCCCGGAGTTCACCGTCCGGCGG
GTACGCGCGATGAAGCCCGCGATCGAACGCACGGTGGACGCCCAACTGGACGCCATGCTG
GCCGCGGGCAACACCGCCGACCTCGTCGCCGACTTCGCCCTGCCCATCCCCTCCCTGGTG
ATCTCCGCACTGCTCGGCGTGCCGCCCGCCGACCGCGAGTTCTTCGAGTCCAGGACCCGC
GTCCTGGTCTCCCTCCGCTCCTCCACCGACGACGACCGGATGGCCGCCGCCAAGGACCTC
CTGCGGTACATCAACCGGCTCGTGGAGATCAAACAGAAGTGGGGCGGCGACGACCTCATC
ACCCGGCTGCTGGCCACCGGTGCCATCGCCCCCCACGAAATGTCCGGCGTGCTGATGCTC
CTGCTCATCGCCGGCCACGAGACCACGGCCAACAACATCGCCCTCGGCGTGGTCACCCTG
CTGGCGAACCCCCAATGGATCGGCGACGACCGGGCCGTGGAGGAGACCCTGCGCTTCCAC
TCCGTCGCCGACCTGGTGTCCCTGCGCGTCGCGGTCCAGGACGTGGAAATCGCCGGGCAG
CTCATCAAGGCGGGCGAGGGAATCGTGCCGCTGGTCGCCGCCGCCAATCATGACGAGAAC
GCCTTCGAATGCCCCCACGCCTTCGACCCGTCCCGGTCCGCCCGCCACCATGTGGCCTTC
GGCTACGGCGTACACCAATGCCTGGGACAGAACCTGGTGCGGATCGAGATGGAAGTCGCG
TACCGGAAACTCTTCGAGCGCATCCCGAACCTCGAACTCGCCGTGCCCACCGACGGGTTG
GACATCAAGTACGACGGCGTGCTCTACGGCCTGAACGAGCTGCCCGTCCGCTGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [271-366]  6.40000000000001e-19 PF00067
PF00067   p450
 [244-261]  2.19999900980708e-08 PR00385 [271-282]  2.19999900980708e-08 PR00385 [338-347]  2.19999900980708e-08 PR00385 [347-358]  2.19999900980708e-08 PR00385
PR00385   P450
 [6-398]  3.70000000000004e-95 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [15-398]  1.69998802370953e-86 SSF48264
SSF48264   Cytochrome_P450
IPR002397 Cytochrome P450, B-class (Family)
 [100-111]  3.49999466863949e-46 PR00359 [147-163]  3.49999466863949e-46 PR00359 [164-179]  3.49999466863949e-46 PR00359 [202-224]  3.49999466863949e-46 PR00359 [289-316]  3.49999466863949e-46 PR00359 [317-332]  3.49999466863949e-46 PR00359 [338-347]  3.49999466863949e-46 PR00359 [347-358]  3.49999466863949e-46 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [340-349]  PS00086
PS00086   CYTOCHROME_P450
SignalP
 [1-33]  0.052 Signal
Bacteria, Gram-negative   
TMHMM No significant hit