close all open/close all

CDS information : Pimar_00150


close this sectionLocation

Organism
StrainATCC 27448 (=NBRC 13367)
Entry namePimaricin
Contig
Start / Stop / Direction60,782 / 60,973 / + [in whole cluster]
54,038 / 54,229 / + [in contig]
Location60782..60973 [in whole cluster]
54038..54229 [in contig]
TypeCDS
Length192 bp (63 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.5 electron carrier
Productputative ferredoxin
Product (GenBank)PimF protein
Gene
Gene (GenBank)pimF
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11094342] A complex multienzyme system encoded by five polyketide synthase genes is involved in the biosynthesis of the 26-membered polyene macrolide pimaricin in Streptomyces natalensis. (Chem Biol. , 2000)
Related Reference
ACC
P18324
PmId
[1846297] Ferredoxins from two sulfonylurea herbicide monooxygenase systems in Streptomyces griseolus. (Biochemistry. , 1991)

close this sectionSequence

selected fasta
>putative ferredoxin [PimF protein]
MRITVDPDRCVGAGQCALNAPALFDQDDDGLVTLLTEPGADQYDKARLAGALCPSGAITV
HEG
selected fasta
>putative ferredoxin [PimF protein]
ATGCGTATCACCGTTGACCCCGACCGCTGCGTGGGAGCAGGCCAGTGCGCGCTCAACGCG
CCCGCGCTCTTCGACCAGGACGACGACGGACTCGTCACCCTCCTCACCGAGCCCGGCGCC
GACCAGTACGACAAGGCCCGGCTGGCCGGCGCCCTGTGCCCGTCCGGGGCGATCACCGTG
CACGAGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001080 3Fe-4S ferredoxin (Family)
 [5-16]  3.30000164480624e-05 PR00352 [16-26]  3.30000164480624e-05 PR00352 [46-58]  3.30000164480624e-05 PR00352
PR00352   3FE4SFRDOXIN
IPR010693 Ferredoxin soy-like (Family)
 [1-61]  3.3e-14 PF06902
PF06902   DUF1271
IPR017896 4Fe-4S ferredoxin-type, iron-sulpur binding domain (Domain)
 [1-29]  PS51379
PS51379   4FE4S_FER_2
SignalP No significant hit
TMHMM No significant hit