close all open/close all

CDS information : Pimar_00160


close this sectionLocation

Organism
StrainATCC 27448 (=NBRC 13367)
Entry namePimaricin
Contig
Start / Stop / Direction61,053 / 66,596 / + [in whole cluster]
54,309 / 59,852 / + [in contig]
Location61053..66596 [in whole cluster]
54309..59852 [in contig]
TypeCDS
Length5,544 bp (1,847 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)PimS0 protein
Gene
Gene (GenBank)pimS0
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[10187796] The biosynthetic gene cluster for the 26-membered ring polyene macrolide pimaricin. A new polyketide synthase organization encoded by two subclusters separated by functionalization genes. (J Biol Chem. , 1999)
[11094342] A complex multienzyme system encoded by five polyketide synthase genes is involved in the biosynthesis of the 26-membered polyene macrolide pimaricin in Streptomyces natalensis. (Chem Biol. , 2000)

close this sectionPKS/NRPS Module

0
CoL57..462
ACP560..642
ks661..1037
AT1209..1532
ACP1722..1766

close this sectionSequence

selected fasta
>polyketide synthase [PimS0 protein]
MVPVHTDDYAIQPPADTAHGGGGFTLPAVFEAAVESAPDAVALVDGTVPGPGRMWRADVD
ALARGLQESGIAPGDVVAVRLPNCGRFPTLHLAVAAVGAVLLPIHQGTPLPEVDALLTRA
EPALLVLSAAGSDGLATARSLLESVPSLRGVLLAGASGDGESGSVGGGESGSGRRSLDGL
LAGWAGSGPRPVDVTPDMPLVLVPSSGTVSARPKLCVHSHDGLLSNTAAVTAEAADAFDG
PVLTACPMTHLFGLQSLHAALFAACTQVLLTGWDVDRFLEQAREHGPRVVFAVPAQLRDV
VTRLARTGEPAGFTPYQVRTAGAAVAPALAVRVRAVLDCELVVVWGMSEIGTGTRTRAHH
PDGCVGEPVSGVDVRVVDEHGQECAADERGELQYRGPGLFRGYFREPELTRSALTDDGWL
RTGDLATVDADGVVVLHGRAAELINTGGRKFSAGEVEGLLSGFTDLGPLAVVGAPDDRLG
EYPCLVVTDHADGTIGLSEVTAFLRRLGLADHKIPLELVTVRELPFSPAGKLDRGALKRL
LANLAEVSVPARLGAVPPYTAEEALDLVRDCVGRVLRYGGAAVPFPPDKDFFSPDKDFRQ
LGLDSIGAVRLRNLLREETGLPLPATLAFDSPTPRAVARVLAEQEEPSQDEPRENPADGA
DPVAIVGMACRLPGGADSPDALWELLADGTDAMSPFPTDRGWDLDRLFDEDADRPGTSYA
REGGFLHDAGDFDAGFFGLSDQEATATDPQQRLLLEAAWETFERAGIDPQSLRGSRTGVF
TGAMDRGYGTSASAAPSAWESMLITGTAGSAVSGRIAYTYGLEGPALTVDTASSSSLVAL
HLACRSLRSGETDLALAGGVTVMATPAPFAHFSRLRALSPDSRSMAYADAANGSAWSEGA
GLLLLERLSDARRNGHRVLALVRGSAVNQDGASNGLTAPSGPAQQRVIRQALADAGLTPQ
DVDAVEGHGTGTPLGDPIEAQALLATYGQQRPVERPLWLGSVKSNFGHTQAAAGVVGVIK
TVLALRHGVLPQTLHVDAPSAKVDWSAGSVRLLTEARPWPRESGRTRRAGVSSFGLTGTN
AHVILEEAPGEAAAGARAEVPEEARCASSPARLPEPPGDAAAPWVLSARSRAALRAQALR
LADQVAADPGLRAQDVAHALATSRTLHRHRAVVSGSDRAQMLAAAKRFGLGERTAGVTPD
DSAPGLLAFVFSGQGSQRSGMGRAAAEAFPVFGRALGEVCAALDPLLTRPLTSVMWAAPG
SEEAARLDDTTYTQPALFAVQVALYRLFESWGVVPDQLVGHSVGEISAAHVAGVLGLRDA
CTLVAARSRLMGALPPGGAMVAVRITEPEVTPWLAELTDEVSIAAVNGPHSLVLAGAEAP
LVALTDRLAAAGHKTRRLMVSTAPHSPLMDPMLEEFRAVVRTLSYAAPAVPLVSTVTGRP
LTGEEARDPDHWVRHVRQSVRFKDAIGRLRDERVTGFLELGAEPALTPMIDECLESADGQ
PGTALVPSLRAGVPERDALLTAVARVHAQGVPVDWDAVLPGAEASVTVRGLPAADRQWFR
FVPDQGAPLTLADRSLHLEGAAHLRDVGGCRTADGRWVKMGVLYRTNNLHALTDADLAKL
QRLGIRTDFDLRMPGERAKAPNRVPTGARYIVADAFDAHLRDGLSLSERDLERLREARLS
GLDEAEQHALVLALVLAETSAVLGGQETPGEEPHGEEGHRTFKEMGINSLNAVELRNRLI
AATDLRLPATLVYDYPTPKAVVRLVRERLARPASPARDVASVVAELESLLTAGAEVSEET
AARLKAVTAVSTGTTGSGSGTGAGSGGALDLVSASDEELFRLMDAES
selected fasta
>polyketide synthase [PimS0 protein]
ATGGTGCCCGTCCACACAGATGACTACGCGATCCAGCCGCCCGCCGACACCGCGCATGGA
GGGGGTGGCTTCACACTGCCTGCTGTGTTCGAGGCCGCCGTGGAATCCGCCCCCGACGCA
GTGGCCCTCGTCGACGGCACCGTTCCTGGACCTGGGCGCATGTGGCGCGCAGACGTCGAT
GCGCTGGCCCGCGGGTTGCAGGAGTCGGGTATCGCACCCGGTGACGTGGTGGCGGTGCGG
CTGCCGAACTGCGGGAGGTTTCCCACCCTGCACCTGGCCGTCGCGGCCGTCGGAGCGGTA
CTGCTGCCCATCCACCAGGGCACCCCGCTCCCGGAGGTCGACGCGCTGCTGACCCGGGCG
GAACCCGCCCTTCTCGTCCTGTCGGCCGCCGGGAGCGACGGCCTGGCGACGGCCCGTTCG
CTTCTGGAGAGCGTGCCGTCGCTGCGCGGCGTGCTGCTGGCCGGGGCGTCGGGAGACGGG
GAGTCCGGATCCGTCGGAGGTGGGGAGTCAGGATCCGGGCGTCGGTCGCTGGACGGGCTG
CTGGCCGGCTGGGCGGGCAGCGGGCCCCGGCCGGTGGACGTCACCCCCGATATGCCGCTC
GTTCTCGTCCCCTCGTCCGGGACGGTCTCGGCACGGCCCAAACTGTGTGTGCACAGCCAC
GACGGTCTGCTGTCGAACACCGCAGCCGTCACCGCCGAGGCCGCCGACGCCTTCGACGGT
CCGGTCCTCACGGCCTGCCCGATGACCCATCTGTTCGGCCTCCAGTCCCTGCACGCGGCG
CTGTTCGCCGCCTGCACGCAGGTCCTGCTCACCGGCTGGGACGTGGACCGCTTCCTGGAA
CAGGCTCGGGAGCACGGCCCCCGTGTCGTGTTCGCCGTGCCCGCCCAACTGCGGGACGTC
GTGACACGACTGGCCAGGACCGGCGAACCGGCGGGCTTCACGCCGTACCAGGTGCGTACC
GCGGGGGCCGCCGTCGCGCCCGCGCTCGCCGTACGGGTACGCGCCGTCCTCGACTGCGAA
CTGGTCGTGGTGTGGGGGATGTCCGAGATCGGCACCGGCACCCGCACCCGGGCCCACCAC
CCCGACGGCTGTGTGGGAGAGCCGGTCAGCGGGGTGGACGTGCGCGTCGTCGACGAGCAC
GGCCAAGAGTGCGCGGCGGACGAGAGGGGTGAACTCCAGTACCGGGGGCCAGGGTTGTTC
CGCGGCTATTTCCGCGAACCGGAGCTGACGCGCTCGGCCCTCACCGACGACGGCTGGCTG
CGGACCGGCGATCTCGCGACCGTCGACGCGGACGGCGTGGTGGTGCTGCACGGCCGGGCG
GCCGAGCTGATCAATACGGGGGGCCGGAAGTTCAGCGCCGGCGAGGTCGAGGGACTGCTC
TCCGGCTTTACGGACCTGGGCCCGCTGGCCGTCGTCGGCGCACCGGACGACCGGCTCGGG
GAGTACCCGTGCCTGGTCGTGACCGACCACGCGGACGGCACCATCGGCCTGAGCGAGGTG
ACCGCGTTCCTGCGCCGGCTGGGGCTCGCCGACCACAAGATCCCCCTCGAACTGGTCACC
GTGCGCGAGCTTCCCTTCTCCCCTGCCGGGAAGCTCGACCGCGGGGCGCTCAAGCGGCTG
CTCGCCAACCTTGCGGAGGTGTCCGTTCCGGCCCGTCTCGGCGCGGTCCCGCCCTACACG
GCCGAGGAGGCGCTGGACCTCGTACGCGACTGCGTCGGCCGGGTGCTCCGTTACGGCGGC
GCGGCCGTCCCCTTCCCCCCGGACAAGGACTTCTTCTCCCCGGACAAGGACTTCCGCCAG
CTCGGCCTGGACTCCATCGGCGCGGTGCGGCTGCGGAATCTGCTGCGGGAGGAGACCGGG
CTGCCGCTCCCGGCCACCCTGGCCTTCGACTCCCCCACTCCGCGAGCCGTCGCGCGCGTC
CTGGCCGAGCAGGAGGAGCCGTCCCAGGACGAGCCGAGGGAGAACCCGGCGGACGGTGCC
GACCCGGTGGCGATCGTGGGCATGGCCTGCCGGCTGCCGGGCGGAGCCGACTCCCCCGAC
GCCCTGTGGGAGCTGCTCGCCGACGGGACCGACGCGATGTCCCCCTTCCCCACGGACCGC
GGCTGGGACCTGGACCGGCTGTTCGACGAGGATGCCGACCGCCCGGGTACCTCGTACGCC
CGCGAAGGCGGCTTCCTGCACGACGCGGGCGACTTCGACGCGGGCTTCTTCGGCCTGTCG
GACCAGGAGGCGACGGCGACCGATCCGCAGCAGCGGCTGCTTCTGGAGGCGGCCTGGGAG
ACCTTCGAGCGGGCGGGCATCGACCCGCAGTCCCTGAGGGGAAGCCGTACGGGCGTGTTC
ACGGGCGCGATGGACCGCGGCTATGGAACCAGCGCGTCCGCCGCGCCCAGCGCATGGGAG
AGCATGCTCATCACCGGGACCGCCGGCAGCGCGGTCTCGGGGCGCATCGCCTACACCTAC
GGGCTCGAAGGCCCCGCGCTGACGGTCGACACCGCCTCCTCGTCCTCCCTCGTCGCCCTG
CATCTGGCCTGCCGGTCGCTGCGCTCGGGCGAGACCGACCTGGCGCTGGCCGGCGGCGTC
ACCGTCATGGCGACCCCGGCGCCCTTCGCACACTTCTCCCGGCTGCGCGCGCTGTCCCCC
GACTCCCGCTCCATGGCGTACGCGGACGCCGCGAACGGCTCGGCGTGGTCGGAGGGCGCG
GGGCTGCTTCTGCTGGAGCGGCTGAGCGACGCCCGGCGCAACGGACACCGTGTCCTGGCG
CTCGTACGGGGCTCCGCCGTGAATCAGGACGGCGCCTCCAACGGGCTCACCGCGCCGAGC
GGACCCGCACAGCAGCGCGTCATCCGCCAGGCCCTGGCCGACGCCGGGCTGACGCCGCAG
GACGTGGACGCCGTGGAGGGGCACGGCACCGGCACGCCGCTCGGCGACCCCATCGAGGCG
CAGGCGCTGCTGGCCACGTACGGCCAACAGCGGCCTGTGGAACGGCCGTTGTGGCTGGGG
TCGGTGAAGTCGAACTTCGGGCACACACAAGCCGCCGCCGGGGTCGTCGGCGTCATCAAG
ACGGTGCTCGCGCTGCGCCACGGCGTCCTGCCGCAGACGCTGCACGTGGACGCTCCCTCG
GCCAAGGTGGACTGGTCCGCCGGTTCGGTACGGCTGCTGACCGAGGCGCGGCCCTGGCCA
CGGGAGAGCGGACGTACGCGCCGGGCGGGGGTGTCCTCGTTCGGGCTCACCGGCACCAAC
GCGCACGTGATCCTGGAGGAGGCGCCGGGAGAGGCGGCGGCAGGGGCGCGGGCCGAGGTT
CCCGAGGAGGCGCGGTGCGCCTCCTCACCGGCTCGACTCCCGGAGCCGCCCGGCGACGCG
GCCGCGCCCTGGGTGCTGTCCGCCCGGAGCCGGGCGGCGCTGCGCGCGCAGGCGCTCCGC
CTGGCCGACCAGGTGGCCGCCGACCCCGGTCTACGGGCCCAGGATGTCGCCCATGCCCTG
GCCACCTCCCGTACCCTGCACCGGCACCGGGCCGTCGTCAGCGGCTCCGACCGGGCACAA
ATGCTCGCCGCGGCAAAGCGGTTCGGGCTCGGTGAGCGGACCGCGGGCGTCACCCCGGAC
GATTCCGCGCCGGGCCTGCTGGCCTTCGTCTTCTCCGGGCAGGGCAGCCAGCGCAGCGGC
ATGGGGCGCGCGGCGGCCGAGGCGTTCCCGGTCTTCGGACGGGCGCTGGGCGAGGTGTGC
GCCGCGCTGGACCCGCTGCTGACACGCCCACTGACCTCGGTGATGTGGGCGGCTCCCGGC
TCCGAGGAGGCGGCCCGTCTCGACGACACCACCTACACGCAGCCCGCCCTGTTCGCCGTC
CAGGTCGCCCTGTACCGGCTGTTCGAGTCCTGGGGCGTGGTGCCGGACCAGCTGGTGGGG
CATTCGGTCGGCGAGATCTCCGCCGCCCATGTGGCAGGCGTGCTCGGCCTCCGGGACGCG
TGCACCCTGGTGGCGGCCCGTAGCAGGCTGATGGGCGCGCTGCCGCCCGGCGGTGCGATG
GTGGCGGTACGCATCACGGAACCCGAAGTGACCCCATGGCTCGCGGAGTTGACGGACGAG
GTGTCGATCGCGGCCGTCAACGGTCCGCACTCCCTCGTGCTCGCGGGCGCCGAGGCCCCG
CTCGTCGCCCTCACGGACCGGCTCGCCGCCGCCGGACACAAGACCCGGCGCCTCATGGTG
AGCACCGCGCCCCACTCGCCGCTGATGGACCCCATGCTGGAGGAGTTCCGCGCGGTCGTC
CGCACGCTGTCCTACGCCGCGCCCGCCGTTCCCCTCGTCTCCACCGTCACCGGCCGCCCG
CTGACCGGCGAGGAGGCGCGCGACCCGGACCACTGGGTGCGGCATGTGCGGCAGTCCGTC
CGCTTCAAGGACGCGATCGGCCGGCTCCGGGACGAACGCGTCACCGGGTTCCTGGAGCTG
GGTGCCGAACCGGCACTCACACCGATGATCGACGAGTGCCTGGAGTCCGCCGACGGGCAG
CCCGGGACCGCCCTGGTGCCGAGTCTGCGCGCCGGAGTGCCGGAGCGGGATGCCCTGCTC
ACCGCGGTCGCCCGGGTGCACGCCCAGGGCGTTCCCGTCGACTGGGACGCGGTGCTCCCC
GGGGCCGAGGCTTCCGTCACCGTGCGCGGACTGCCCGCCGCCGACCGCCAGTGGTTCCGC
TTCGTCCCCGACCAGGGCGCGCCGCTCACCCTCGCCGACCGCTCGCTGCACCTGGAGGGC
GCCGCCCACCTCCGCGACGTGGGCGGCTGTCGCACCGCCGACGGCCGGTGGGTGAAAATG
GGCGTCCTGTACCGCACCAACAATCTGCACGCGCTCACCGACGCCGACCTGGCCAAGCTC
CAGCGCCTCGGCATCCGTACGGACTTCGACCTGCGCATGCCGGGCGAGCGCGCCAAAGCC
CCGAACCGCGTGCCCACGGGCGCGCGCTATATCGTCGCCGATGCCTTTGACGCACATCTG
CGGGACGGGCTGAGTCTGAGCGAGCGGGACCTGGAGCGGCTGCGCGAGGCCCGGCTGTCC
GGTCTCGACGAGGCCGAACAGCACGCGCTCGTACTGGCCCTGGTCCTCGCCGAGACCTCG
GCCGTGCTCGGCGGCCAGGAGACGCCTGGCGAGGAGCCGCACGGCGAGGAGGGCCACCGC
ACGTTCAAGGAGATGGGCATCAACTCGTTGAACGCCGTCGAACTGCGCAACCGCCTTATC
GCAGCCACGGACCTGCGGCTTCCCGCCACGCTCGTCTACGACTACCCCACGCCGAAGGCC
GTCGTCCGACTCGTACGCGAACGACTCGCGCGACCGGCCTCCCCCGCACGCGATGTGGCC
TCCGTCGTGGCCGAGTTGGAGTCCCTGCTGACGGCCGGTGCGGAGGTCTCGGAGGAGACC
GCGGCGCGGTTGAAAGCGGTGACGGCGGTGTCGACGGGGACGACGGGGTCGGGCAGCGGT
ACGGGCGCCGGCTCCGGCGGGGCTCTGGACCTGGTATCGGCCAGTGACGAGGAACTGTTC
CGGCTGATGGACGCGGAGAGCTGA
[0] CoL57..462
[0] ACP560..642
[0] ks661..1037
[0] AT1209..1532
[0] ACP1722..1766
[0] CoL169..1386
[0] ACP1678..1926
[0] ks1981..3111
[0] AT3625..4596
[0] ACP5164..5298

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [57-462]  1.39999999999997e-70 PF00501
PF00501   AMP-binding
IPR001227 Acyl transferase domain (Domain)
 [1205-1334]  5.00000000000001e-71 G3DSA:3.40.366.10 [1402-1522]  5.00000000000001e-71 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [600-615]  PS00012 [1724-1739]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [568-640]  1.1e-09 PF00550 [1717-1765]  3.1e-06 PF00550
PF00550   PP-binding
 [560-642]  PS50075 [1722-1766]  PS50075
PS50075   ACP_DOMAIN
 [557-677]  1e-22 SSF47336 [1682-1773]  4.30000170645867e-14 SSF47336
SSF47336   ACP_like
 [592-668]  1.6e-27 G3DSA:1.10.1200.10 [1718-1770]  6.00000000000001e-30 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [661-911]  1.69999999999998e-88 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [919-1037]  2.70000000000002e-49 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [1209-1532]  1.2e-60 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [1207-1523]  4.69998262513189e-65 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [1336-1401]  1.59999889349252e-16 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [669-923]  2.50000000000001e-86 G3DSA:3.40.47.10 [924-1090]  8.19999999999987e-67 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [653-1035]  1.19999063421924e-99 SSF53901
SSF53901   Thiolase-like
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [1210-1513]  2.0000139277205e-115 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [565-645]  8.49999291746323e-24 SM00823 [1692-1769]  1.10000150671642e-21 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [663-1090]  SM00825
SM00825   PKS_KS
SignalP No significant hit
TMHMM No significant hit