close all open/close all

CDS information : Pimar_00180


close this sectionLocation

Organism
StrainATCC 27448 (=NBRC 13367)
Entry namePimaricin
Contig
Start / Stop / Direction88,162 / 89,355 / + [in whole cluster]
81,418 / 82,611 / + [in contig]
Location88162..89355 [in whole cluster]
81418..82611 [in contig]
TypeCDS
Length1,194 bp (397 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productepoxidase
cytochrome P450
Product (GenBank)PimD protein
Gene
Gene (GenBank)pimD
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11094342] A complex multienzyme system encoded by five polyketide synthase genes is involved in the biosynthesis of the 26-membered polyene macrolide pimaricin in Streptomyces natalensis. (Chem Biol. , 2000)
[15228385] Characterization of the polyene macrolide P450 epoxidase from Streptomyces natalensis that converts de-epoxypimaricin into pimaricin. (Biochem J. , 2005)

close this sectionSequence

selected fasta
>epoxidase [PimD protein]
MTAASHDLPCLNLEPPKMLKLSPLLRALQDRGPIHRVRTPAGDEAWLVTRHAELKQLLHD
ERIGRTHPDPPSAAQYVRSPFLDLLISDADAESGRRQHAETRRLLTPLFSARRVLEMQPK
VEEAADTLLDAFIAQGPPGDLHGELTVPFALTVLCEVIGVPPQRRAELTTLLAGIAKLDD
REGAVRAQDDLFGYVAGLVEHKRAEPGPDIISRLNDGELTEDRVAHLAMGLLFAGLDSVA
SIMDNGVVLLAAHPDQRAAALADPDVMARAVEEVLRTARAGGSVLPPRYASEDMEFGGVT
IRAGDLVLFDLGLPNFDERAFTGPEEFDAARTPNPHLTFGHGIWHCIGAPLARLELRTMF
TKLFTRLPELRPELPVEQLRLKEGQLSGGFAELRVVW
selected fasta
>epoxidase [PimD protein]
ATGACCGCCGCCTCCCACGACCTGCCCTGCCTCAACCTCGAACCGCCCAAAATGCTGAAA
CTGAGCCCGCTGCTGCGCGCCTTGCAGGACCGGGGGCCGATCCACCGGGTGCGCACACCC
GCCGGGGACGAGGCGTGGCTGGTGACCCGCCACGCCGAGCTCAAGCAGCTGCTGCACGAC
GAGCGCATCGGCCGCACGCACCCCGACCCGCCCTCCGCCGCCCAGTACGTACGCAGCCCC
TTCCTGGACCTGCTGATCAGCGACGCCGACGCCGAGTCCGGGCGTCGGCAGCACGCCGAG
ACCCGCCGCCTGCTCACTCCGTTGTTCTCGGCCCGGCGCGTTCTGGAAATGCAGCCGAAG
GTGGAGGAGGCCGCGGACACCCTGCTGGACGCGTTCATCGCCCAGGGGCCTCCCGGCGAC
CTGCACGGCGAGCTCACCGTGCCGTTCGCCCTCACGGTCCTCTGCGAGGTCATCGGCGTG
CCGCCGCAGCGCCGCGCGGAGCTGACCACACTGCTGGCCGGTATCGCCAAGCTGGACGAC
CGCGAGGGCGCCGTACGGGCACAGGACGACCTGTTCGGGTACGTGGCAGGGCTGGTCGAG
CACAAGCGGGCCGAGCCCGGCCCAGACATCATCTCCCGGCTGAACGACGGCGAGCTGACC
GAGGACCGCGTGGCACACCTGGCCATGGGCCTGCTGTTCGCCGGGCTGGACAGCGTCGCG
AGCATCATGGACAACGGGGTGGTGCTGCTGGCCGCCCACCCCGATCAGCGCGCGGCGGCG
CTGGCCGACCCCGACGTGATGGCGCGTGCCGTGGAGGAGGTGCTGCGGACCGCCCGGGCC
GGCGGGTCGGTCCTGCCGCCGCGCTACGCCAGCGAGGACATGGAATTCGGCGGGGTGACG
ATACGGGCCGGAGACCTGGTCCTGTTCGACCTCGGCCTGCCCAACTTCGACGAGCGGGCG
TTCACAGGGCCGGAGGAATTCGACGCCGCCAGGACCCCCAATCCCCATCTGACCTTCGGC
CACGGCATCTGGCACTGCATCGGCGCCCCCCTCGCGCGCCTGGAACTCAGGACGATGTTC
ACCAAGCTGTTCACCCGCCTGCCGGAACTGCGCCCGGAACTTCCGGTGGAGCAACTGCGC
CTGAAGGAGGGCCAGCTGTCGGGCGGCTTCGCCGAGCTCCGGGTGGTCTGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [12-397]  1.3000049540733e-77 SSF48264
SSF48264   Cytochrome_P450
 [17-397]  6.7999999999999e-89 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [215-366]  3.3e-15 PF00067
PF00067   p450
IPR002397 Cytochrome P450, B-class (Family)
 [140-156]  5.8999880940569e-37 PR00359 [157-172]  5.8999880940569e-37 PR00359 [193-215]  5.8999880940569e-37 PR00359 [269-280]  5.8999880940569e-37 PR00359 [288-315]  5.8999880940569e-37 PR00359 [316-331]  5.8999880940569e-37 PR00359 [337-346]  5.8999880940569e-37 PR00359 [346-357]  5.8999880940569e-37 PR00359
PR00359   BP450
SignalP No significant hit
TMHMM No significant hit