close all open/close all
Pimar_00180 Pimar_00180   last last

CDS information : Pimar_00190


close this sectionLocation

Organism
StrainATCC 27448 (=NBRC 13367)
Entry namePimaricin
Contig
Start / Stop / Direction90,901 / 89,603 / - [in whole cluster]
84,157 / 82,859 / - [in contig]
Locationcomplement(89603..90901) [in whole cluster]
complement(82859..84157) [in contig]
TypeCDS
Length1,299 bp (432 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative major facilitator superfamily transporter
Product (GenBank)PimH protein
Gene
Gene (GenBank)pimH
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11094342] A complex multienzyme system encoded by five polyketide synthase genes is involved in the biosynthesis of the 26-membered polyene macrolide pimaricin in Streptomyces natalensis. (Chem Biol. , 2000)
Family/Domain
FD
IPR011701

close this sectionSequence

selected fasta
>putative major facilitator superfamily transporter [PimH protein]
MLATLTVRNFRRYLIGQLTSNIGTWMQRAAQDLLVLHLTGNSGSAVGLVTALQFLPQTLF
GLTGGVLADRFPKRRLLLITQTAMAVQSLLLGVLTVTEAVNLPSVYALAFALGTATAMDT
PARNAFISELVARERVPAAVSLNSAQFNIARTLGPAIAGLTVAAAGTGPVFLLNAASYLA
VLYGLISIRPAELSSPGPPRHGGTRLRDAFRHIRSTPDLLLPITLIGFVGTFGLNFQVTT
SLMAITVFHSGAAVFGYLSAAYAIGSLIGALRGAGRGQPPTAPRLITATVVFGTLEAVLG
LMPGYGTFLALLIPTGLAAATVTTTANSLTQLHADPHLRGRVMSVYFLVLLGGTPIGAPL
VGLVSDTLGARSTLILAGIVSAASALALPALVSARTRRLDRTNKPMTQADAPLTDTPGPA
LSGKAPTNQSTT
selected fasta
>putative major facilitator superfamily transporter [PimH protein]
GTGCTCGCCACGCTCACCGTCCGGAACTTCCGCCGCTACCTGATCGGACAGCTGACCTCC
AACATCGGCACCTGGATGCAGCGCGCCGCCCAGGACCTGCTGGTCCTCCACCTCACCGGC
AACAGCGGCAGCGCCGTCGGCCTCGTGACCGCCCTCCAGTTCCTTCCCCAGACCCTGTTC
GGCCTGACCGGCGGCGTCCTTGCCGACCGCTTCCCCAAGCGACGGCTGCTGCTGATCACG
CAGACGGCCATGGCGGTGCAATCGCTGCTGCTCGGTGTCCTGACCGTCACCGAGGCGGTG
AACCTGCCCTCCGTGTACGCCCTGGCGTTCGCCCTCGGTACCGCCACCGCCATGGACACT
CCCGCCCGCAACGCCTTCATCTCCGAACTGGTCGCCCGAGAGCGGGTGCCCGCCGCGGTC
AGCCTGAACTCCGCCCAGTTCAACATCGCCCGCACCCTCGGCCCGGCCATCGCGGGCCTG
ACGGTCGCCGCGGCCGGCACCGGCCCGGTATTCCTCCTCAATGCCGCCTCGTACCTGGCC
GTCCTGTACGGGCTGATCAGCATCCGTCCCGCCGAACTGAGCAGCCCAGGCCCGCCCCGG
CACGGCGGGACACGGCTCCGCGACGCCTTCCGCCACATCAGATCCACCCCAGACCTGCTT
CTGCCCATCACGCTCATCGGCTTCGTCGGCACCTTCGGCCTCAACTTCCAGGTCACCACC
TCCCTCATGGCGATCACGGTCTTCCACTCCGGCGCCGCCGTCTTCGGCTACCTCTCGGCC
GCCTACGCCATCGGCAGCCTCATCGGCGCGCTCCGCGGCGCCGGCCGCGGGCAGCCCCCC
ACCGCACCACGCCTGATCACCGCCACGGTCGTCTTCGGGACACTGGAAGCCGTGCTGGGC
CTGATGCCCGGCTACGGCACGTTCCTGGCCCTACTGATCCCGACCGGCCTCGCCGCTGCC
ACCGTGACCACGACCGCCAACTCCCTGACCCAGCTGCACGCCGACCCACATCTGCGCGGC
CGTGTCATGTCCGTCTACTTCCTGGTGCTCCTCGGCGGAACACCCATCGGCGCCCCCCTC
GTCGGCCTGGTGTCCGACACCCTCGGCGCCCGCTCCACCCTGATCCTCGCCGGCATCGTC
TCGGCGGCCTCCGCGCTCGCCCTCCCCGCACTGGTCAGCGCGCGAACCCGACGGCTGGAC
CGGACCAACAAGCCGATGACCCAGGCCGATGCACCCCTCACCGACACCCCCGGTCCGGCG
CTCTCCGGCAAGGCTCCGACCAATCAGTCCACTACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011701 Major facilitator superfamily (Family)
 [36-346]  6.49999999999992e-33 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [8-398]  7.30000590915205e-46 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [1-396]  PS50850
PS50850   MFS
SignalP No significant hit
TMHMM
 [46-68]  Transmembrane (o-i) [89-111]  Transmembrane (i-o) [157-179]  Transmembrane (o-i) [219-238]  Transmembrane (i-o) [253-275]  Transmembrane (o-i) [282-304]  Transmembrane (i-o) [308-330]  Transmembrane (o-i) [342-364]  Transmembrane (i-o) [374-396]  Transmembrane (o-i)
Transmembrane 9   
Pimar_00180 Pimar_00180   last last