close all open/close all
first first   Pladi_00020 Pladi_00020

CDS information : Pladi_00010


close this sectionLocation

Organism
StrainMer-11107
Entry namePladienolide
Contig
Start / Stop / Direction8,340 / 27,938 / + [in whole cluster]
8,340 / 27,938 / + [in contig]
Location8340..27938 [in whole cluster]
8340..27938 [in contig]
TypeCDS
Length19,599 bp (6,532 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase
Gene
Gene (GenBank)pldAI
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18997414] Organization of the biosynthetic gene cluster for the polyketide antitumor macrolide, pladienolide, in Streptomyces platensis Mer-11107. (Biosci Biotechnol Biochem. , 2008)

close this sectionPKS/NRPS Module

0 methylmalonyl-CoA
not conserved YASHS(S->T)
1 methylmalonyl-CoA
2 malonyl-CoA
3 methylmalonyl-CoA
not conserved YASHS(S->T)
KSQ7..381
AT539..857
ACP925..995
KS1015..1392
AT1555..1874
KR2201..2380
ACP2485..2555
KS2577..2953
AT3122..3442
DH3490..3653
KR3987..4167
ACP4273..4343
KS4364..4741
AT4906..5224
DH5274..5440
ER5774..6081
KR6091..6271
ACP6376..6446

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase]
MLSAADDAIAIIGMSCRLPRAVNPQEFWELLRNGESGITEVPPQRWDANSLFDAERSTPG
TMNTRWGGFIDGVDQFDPGFFGISSREAVAMDPQQRLVLELSWEALEDARIVPERLRHTA
TGVFVGAIWDDYASLMSARGREAVTHHTVTGTHRSIIANRVSYALGLQGPSMAVDSGQSS
SLVSVHLACESLRRGESTLALAGGVNLNLVPESTIGMAKFGGLSPDGRCFTFDTRANGYV
RGEGGGVVVLKPLADAIADQDPIYCVIRGSAVNNDGSGENLTTPNSQAQAAVLREAYRRA
GVDPAQVQYVELHGTGTPVGDPIEAEALGAVIGAARPPGDPLWVGSAKTNIGHLEAAAGI
AGLLKVVLSISHRELPASLNFATANPRIPLDSLNLRVGDELTSWPSAGRPMLAGVSAFGM
GGTNAHAVVEQSPVAARQIPAPGGTPTDQGGPVPWLLSGGSVAAVRGQAARLLSHLEGRS
GLRAVDVGWSLATTRSVFPHRAVVVADDGGYGQSLAALAAGSVDAGVVEGLADVSGKTVF
VFPGQGSQWVGMAVELLDGSEVFAEHMAACARALEPFVGWSLEDVLRQVDGTWSLDRVDV
VQPVLWAVMVSLAGLWQAHGVEPAAVLGHSQGEIAAACVAGALSLEDGARVVALRSRAIA
EALAGHGGMLSIAAPATEVTALITPWGRQITIATVNGPHSVVVAGDPDALEALRGELETR
GLRNRRIPVDYASHTPHVEAIRERLLADLAVIQPRAASIPVLSTVTGAWLDTTVMDAEYW
YRNLRQTVEFEAATRTLLDQDHRYFVEISPHPVLTTAIQETLDVTDTAAVATGTLRRNEG
SLRRFQLALAELVTRGLTPHWPALYPDARHTDLPTYPFQRERYWVGSSSVRDAAPAPQPD
PATGRAAGPASGRAAVDGGDGPAELLALVRAHVAVVLGETTPDSVDPKLTFKQLGFDSVM
SVELRNRLSSATGSSLPSTVLFNHPTPDRLARHLSAEASSQVEGAHDAAPTGAADEPIAI
VGMGCRYPGGVASPEDLWRLVTSGGDAISGFPTDRGWDLEVMYDPDHRRPGTSSTREGGF
LYEAGDFDAGFFGISPREASAMDPQQRLLLETSWEAVERAGIDPLSLHGTRAGVFVGAMA
QEYGPRLDEGADGYEGFLLTGGLTSVLSGRLAYSLGLEGPAVTVDTACSSSLVAVHMAAQ
ALRQGQCSLALAGGVTVMSGPGIFLEFSRQSGLAPDGRCKAFAAGADGTGWAEGVGVLVL
ERLSDARRNGHPVLAVVRGSAINQDGASNGLTAPNGLAQERVIREALTDAGLSPADVDLV
EAHGTGTTLGDPIEAQALIATYGQGRPADRPLRLGSLKSNIGHAQAAAGVGGVIKTVMAV
RHATMPQTLHVDAPSPHVDWSSGQVRLLTEAVPWPESDHPRRAAVSSFGISGTNAHVVVE
QPPAEVSAVTGPSPMAPDEAVPAPGQPVPWLLSGKSPEAVREQAARLRSYLADRPGAGLA
DIGWSLASTRSAFEHRTVVVAADHGQFREALGAAAAGSADARVVEGVADIDGKTVFVFPG
QGAQWAGMAGELLDSSEVFAARMADCARALAPFVGWSLQDVVRQAEGAPPLDRVDVVQPV
LWAVMVSLADLWRAHGVEPSAVVGHSQGEIAAACVAGGLTLEDAARVVSLRSRAIAEVLA
GHGGMLSVTAAREQVEEWLLPWEGRISLATINGTESVVVAGDPDALAEFRAWLGNRQIRS
RTLPVDYASHSAQVEAVHQRLLDDLAPIRPRTCRTPLLSSVTGQWLDTASMDAEYWYQNL
RRTVEFAAATRTLADGGHRIFIEVSSHPVLVGAIRETLEAVEVQAAVAGSLRRDDGGLRR
FRLSLAALVTRGLAPDWSMLCPGVSRTDLPTYPFQRSRYWITAFSGSRSAGELNAADSRF
WEAVDSEDPGRLAEVLSLDDDASLEPVFLALSSWRRRHRVRSTLDDWRYRVTWQPLPGAA
VPLTAATLGGTWLVAVPHEDAYVSQVLRGLGDRGATVITLRADDPRHGPLAERVREALAG
AGEITGVLSLLALDERPHPEHPVLPMGLALNTALVRALVDKDVRAPLWCATRGAVSVGRS
DRLGSPAQAMVWGLGLVAALEHPRHWGGLVDLPETVDERVLNRLVTVISGQRVHGQGAPG
QDGENPGDEDQLAVRASGVFARRLSHAPVSGSRNREWTPRGTVLVTGGTGGAGTQVARWL
ARNGAEHLLLTSRRGRDAEGAAELAAELTEAGVRVTVAACDVADRDALARLLAGVPDELP
LTAVIHAAGVVTTAPLDSTGPEELAEVLAGKVAGAAHLDALLGDRQLDAFVLFSSNAGVW
GSGGQAAYAAANAYLDALAQQRSSMGQTATSVAWGAWGGAGMAAEEGFKERLRRRGIIEM
DPELAVTALVQAVESGEASIAVADVDWARFVPGFTSNRPSPLIGDLPEVRDALREADSRP
AVDQGGSALATRLAGLSVLERERVLLNLVRTEVASVLGHTTADMVDARRPFRELGFDSLI
AVEFRGRLNAATGLRLPTSVAFDHPTPAELAGHLRELFAGSRGDTAMPVSVTTAGDDEPI
AIVAMSCRYPGGVRTPEDLWRLVAEGRDAITDFPTDRGWDIESLYDPDPGRSGTSYTRRG
GFLDDAAAFDPAFFRISPREALAMDPQQRLLLEMTWETLERALIDPTTLKGSQAGVFIGT
AHPGYGEGIHHESQGVEGQQLFGGSAAVAAGRIAYTFGLEGPAMTVDTMCSSSLVALHLA
CQSLRTGESSMALAGGVTVMARPTAFTEFSRHRGLSPDGRCKSFSDAADGTGWAEGAGVL
LLERLSDARRNGHPVLAVIRGSAINQDGASNGLTAPNGPSQQRVIQQALANASLSPADVA
AVEAHGTGTTLGDPIEAQALIAAYGQDRPTDRPLRLGSLKSNIGHAQSAAAVGGVIKMVQ
AIRHGLLPRTLHAEQPSRHVDWSAGSVELLTEAMPWPDNDQPRRAGVSAFGGSGTNAHMI
IEQAPAPDEPEHTDGTSRTSGESGAEQARPLPMVPWVLSARSDTALRAQARRLRAYAAAA
EAGSICDIGWALATTRATLDDRAVVVAAEREGFLTALDALAEDRTAPGLVRGAAGTGVRS
AFLFSGQGSQRLGMGRELYDTSLVFAEALDEVCAQLDGHLDRPLLRVLFAAEGSDDASML
DQTAFTQAALFAVEVALFRLVWSWGLRPDFLIGHSVGEVAAAHVSGVLSLADAATLVVAR
GRLMQALPSGGAMVALQAGEEEVRLSLAGLEDVVGVAALNGPASTVISGDEEAVLPVAAH
WRAQGRKTRRLKVSHAFHSPRMEPMLHRFHAVLKTLSFAEPAIPVVSNVTGRPAERTELC
AADYWVRHVRHTVRFHDGIRALEAEGVSAFLELGPDGTLSAMVRDCLDTSRPVVTAPVLR
RDRTDVSAALTALAEAHGHGVPVDWASLFAGSTARAVELPTYPFQREHFWLDSVTGSSDM
STAGLASPDHPLLGAVTTVAGEDGLLFTGNLSVRTHPWLADHRITGSVLLPGTAFLELAV
QAGDQAGCGRVEDLTLLAPLVLPEEGSVRVQMKVGEPDATGRRTIEVYSSDQQAPGRERW
VLNASGMLAGEPVEAPPSLTTWPPEGAVPVPLDGFHDRLAARGYGYGPTFRGLSAAWSRG
DEIFAEAALPSGHRQDAARYGLHPALLDAALHAMELREPRPAGDGVRLPFAWNGFSLHAS
GAEAVRLRLAPTGADALSVTLADAIGRPVASARSLALRELSSDLLRPASVSYGDSLFRTA
WIPALVGPEAESGPVRPSAGWAVLGPDPLGAANALNLTGTSCSCYPDLAALIAAVDGGAA
VPEAVLAPYAAEPAPDAGSPADAVRASTGRALQLLQSWLSEDRLERSRLIVLTRGAVAVG
TDEGVTDLVSASVRGLVRSAQAEHPGRFSLVDIDDREESWAVLSAAAVSDEPQLALRCGQ
MKVPRLGSVDVPTTGMPEMPDVWGVDGTVLITGGTGVLGGLVARHLVAGHGVRRLLLCSR
RGPDAPGAVELVAELTALGADVTVAACDAADRDALAALLDTVPATHPLTGVVHTAGVIDD
ATVTTLTPERIDAVLRPKVDAALNLHQLTAHLGLTRFVLFSSAAGLFGGAGQGNYAAANA
FLDALAQHRRANGLNAQSLAWGLWAEASGMTGHLDAADLARVARSGLTAMPTGDGLALLD
TAQRVDEATLVTAALDTRALHARAADGTLPALFHALVPVPRRSATSPAAQAAGPDGLRQR
LSGLVEGERRAALLDLVCGHVARVLGHADPSSIEETRPFKDTGFDSLTAVELRNVLHGAT
GLRLPATLVFDYPTPAALTDHLYDELLGSREDAVLAPITRAAYDEPIAIVGMACRYPGGV
ESPEDLWQLVADGRDAISDFPADRGWNVESLYHPDPDHPGTSYTRAGGFLHDAADFDPEF
FGISPREALATDPQQRLLLETTWEAFEHAGVGPASLRGSRTGVFVGVMYNDYASRIRHIP
ESVEGGLTTNSAGSVASGRVSYTFGLEGPAVTVDTACSSSLVALHLAAQALRNGECTLAL
AGGVAVMSTPATFVEFSRQRGLAADGRCKAFADAADGTGWGEGVGVLLVERLSDARRNGH
PVLAVVSGSAVNQDGASNGLTAPNGPSQQRVIQQALANAGLAGADVDAVEAHGTGTRLGD
PIEAQALIATYGQARSADRPLWLGSLKSNIGHTQAAAGVAGVIKMVQAMQHGTLPPTLHI
DQPTGQVDWATGAVELLTEAVPWPDSDRPRRVAVSSFGVSGTNAHVIIEHTPHTPHTTRT
SQSSQSPQAPQTVQAHRPVPWLLSAKTSQALAAQARRLSAHLRANPDLRSADVAHSLLTT
RSVHAERAVFIAGDRDEALAALDALADGTPAPHLVQGLADVSGKTVFVFPGQGSQWVGMA
VELLDGSEVFAEHMAACARALEPFVDWSLEDVLRQTDGTWPLERVEVVQPVLWAVMVSLA
GLWQAHGVEPAAVLGHSQGEIAAACVAGALSLEDGARVVALRSQAIAETLAGHGGMLSIA
APATDIAPLIARWNERISIATVNGPHSVVVAGDPDALEALRGELETRGLRNRRIPVDYAS
HTPHVEAIRERLLADLAVIQPRAASIPVLSTVTGAWLDTTVMDAEYWYRNLRQTVEFEAA
TRTLLDQDHRYFVEISPHPVLTIGLQQTIEETTAPARTLSTLRRNEGTLRHLFTSLAQAH
AHGLTIDWTPAFTHTEPRTTPLPTYPFQHERYWLEDGAPKSGDVASAGLGSADHPLLGAA
VPLPDSGGFLFTGQLSLRSHPWFADHAVHGTVLLPGTAFVELALQAGGRLGCGLLEELTL
EAPLVLPENSSVQLQLVVNAPDAQDDSGGRTFSVYSRPQDRTADAPWVRHATGVVRSGGA
PEPEGLTVWPPTGAVAVPVEDFYQVLGDRGYDYGPAFRGVRAAWRHGDVVYAEAALAEEQ
QSDAALFHLHPALLDSALHGMGLMPSASAEQTRLPFAWRGVTLHAVGASALRVSLRPAGP
DTVEVLLADGAGRPVASADALVVRPLRQEELAVWQDAYRDWLYRVDWPELPEVPLVAPAG
PWAVLGGNAGGILGTDGSAGLLAGVPIDAYRDLAELRDRTGPSSAFPAVVVAPVATGTGA
APDAVREVTYQVLDMIQSWLADDRSASSTLLLVTRGAVSTGFGDDLVDLGQAAVWGLVRA
AQSENPDRFVLLDLDGSEPVGPLPTAALLSGEPQLAFREGKVLTARLDRVSSDAGTLLPP
AGPDPWRLDVTSRGTLDNLALLAAPQVSAPLAEGQVRVAVHAAGLNFRDVLVALGMYPGE
GSMGSEGAGVVLEVGPGVERLAPGDRVMGMLAGGFFGPVAVTDQRMVTKLPDGWSFTEGA
SVPIVFLTAYYGLVDLGGLRAGQSLLVHAATGGVGMAATQLARHLGAEVFGTASPGKWEA
LRGMGLDEEHIASSRDLDFEKKFSAATGGRGVDVVLNSLAREFVDASLRLLPRGGRFVEM
GKTDIRDAEAVAAGHPGVVYRAFDLLDAAGPDRIQEMLAELLALFEAGVIEPLPLTTWDI
RRAPEALRHLSQARHIGKMVFTLPPAPDPDGTFLITGVPGALGNLVARHLVTEGGIRNLL
LVSRRGPAAPGAEGLATELAGLGATVTLAACDVADRQALAGLLADIPAEHPLTGVVHAAG
VLDDGIVASLTRERLDAVYRPKVDAAWNLHELTKDSGLAAFVLFSSAAATLGSAGQGNYA
AANAFLDALAQFRQAQGLAASSLGWGFWAESGEMTGHLGASDLARMARSGIAALTVEQGL
ALFDSARSGVCASVLPVRLELTGPGARAGSGTVPALMRGLVRAPARRVVETTTGGAVTGL
RQRLAPLSGADRDRALQELVCSHAATVLGHSRSGSVPAQRAFKELGFDSLTAVELRNRLN
VATGLRLPATLVFDHPTPLAMAEQLRKELFADEIPVAPQVLEELDRLEAAFAVSSAGDLQ
QSGAAARLRALLRRIGTVTPAGGDAADGLAVELETATHDEIFALIDEEVGDV
selected fasta
>polyketide synthase [polyketide synthase]
GTGCTCAGTGCGGCTGATGATGCAATAGCCATCATCGGCATGTCTTGCCGGCTGCCGCGA
GCAGTCAATCCTCAGGAGTTCTGGGAACTCCTGAGGAATGGTGAGAGCGGGATTACCGAG
GTGCCGCCCCAGCGGTGGGACGCGAACTCCCTCTTCGATGCGGAACGGTCCACGCCCGGG
ACGATGAATACACGCTGGGGCGGGTTCATCGACGGCGTGGACCAGTTCGACCCCGGCTTC
TTCGGGATCTCCTCCCGCGAAGCGGTCGCCATGGATCCGCAGCAACGGCTCGTACTGGAG
CTGAGCTGGGAGGCCCTGGAGGACGCGCGAATCGTCCCGGAGCGCCTTCGCCACACCGCT
ACCGGTGTCTTCGTCGGCGCGATCTGGGACGACTACGCATCATTGATGAGCGCGCGAGGC
CGAGAAGCGGTGACCCATCACACCGTGACCGGTACGCACCGCAGCATCATTGCCAACCGG
GTGTCGTACGCCCTCGGCCTACAGGGGCCGAGCATGGCGGTGGACTCCGGGCAGTCGTCG
TCACTGGTCTCCGTCCATCTGGCCTGCGAGAGCCTGCGCAGGGGGGAGTCCACGCTCGCG
CTGGCCGGCGGGGTGAATCTCAACCTTGTCCCGGAGAGCACCATCGGCATGGCGAAGTTC
GGCGGGCTCTCCCCCGATGGCCGCTGCTTCACCTTCGACACCCGCGCCAACGGCTACGTG
CGGGGTGAGGGCGGCGGTGTGGTCGTCCTCAAACCGCTGGCGGACGCGATCGCGGACCAG
GACCCGATCTACTGCGTCATCCGTGGCAGCGCCGTCAACAACGACGGTTCCGGTGAGAAC
CTGACCACGCCGAACTCCCAGGCGCAGGCAGCTGTGCTGCGCGAGGCCTACCGCCGCGCC
GGCGTGGACCCGGCCCAGGTCCAGTACGTGGAACTGCACGGTACCGGGACCCCTGTCGGC
GACCCGATTGAAGCCGAGGCCCTCGGCGCGGTGATCGGTGCCGCCCGGCCGCCGGGTGAC
CCCCTGTGGGTGGGATCGGCGAAGACCAACATCGGCCATCTGGAGGCCGCCGCCGGCATC
GCCGGCCTGCTCAAGGTCGTGCTGTCCATCAGCCACCGGGAGCTCCCGGCCAGTCTCAAC
TTCGCCACGGCCAATCCGCGGATTCCACTGGACTCCCTGAACCTGCGCGTGGGCGACGAG
CTCACATCGTGGCCGTCTGCCGGTCGGCCGATGCTCGCCGGTGTGAGCGCGTTCGGCATG
GGCGGTACCAACGCCCACGCCGTGGTCGAACAATCTCCCGTAGCAGCGCGGCAGATTCCG
GCTCCCGGAGGCACGCCGACGGATCAGGGGGGGCCGGTGCCGTGGTTGTTGTCGGGTGGG
TCGGTGGCGGCGGTGCGGGGTCAGGCGGCGCGGTTGTTGTCGCATCTGGAGGGTCGGTCG
GGTCTGCGTGCGGTGGATGTCGGCTGGTCGCTGGCCACGACTCGTTCCGTGTTCCCTCAT
CGTGCTGTTGTCGTTGCCGACGATGGTGGTTACGGCCAGAGTCTCGCCGCGCTGGCCGCG
GGTTCCGTGGATGCCGGGGTGGTTGAGGGCCTTGCCGATGTGAGTGGCAAGACGGTGTTC
GTCTTCCCCGGTCAGGGTTCGCAGTGGGTGGGTATGGCCGTTGAGCTGCTGGACGGCTCG
GAGGTTTTCGCCGAGCATATGGCCGCCTGCGCCAGGGCCCTGGAACCGTTTGTGGGCTGG
TCCCTGGAGGATGTCCTGCGTCAGGTGGACGGTACGTGGTCACTGGATCGTGTGGATGTG
GTCCAGCCTGTGCTGTGGGCGGTCATGGTCTCGCTCGCGGGACTGTGGCAGGCACATGGC
GTTGAGCCTGCTGCGGTGCTGGGCCACTCCCAAGGTGAGATCGCTGCGGCTTGCGTGGCG
GGTGCGCTGAGTCTGGAAGACGGAGCCCGGGTGGTGGCTCTTCGCAGCCGCGCCATCGCC
GAGGCCCTTGCGGGCCATGGCGGGATGCTGTCGATAGCCGCCCCCGCCACCGAAGTCACG
GCCCTGATCACCCCCTGGGGCAGGCAGATCACCATTGCCACGGTCAACGGACCGCATTCG
GTGGTGGTCGCAGGAGACCCTGACGCGCTCGAGGCACTCCGCGGCGAACTGGAGACCCGT
GGTCTCCGCAATCGTCGCATCCCGGTCGACTACGCCTCACACACCCCTCACGTCGAGGCG
ATCCGTGAACGGCTCCTGGCCGACCTGGCAGTGATCCAGCCACGTGCCGCGAGCATTCCC
GTGCTGTCCACCGTCACCGGCGCATGGCTCGACACCACCGTGATGGACGCCGAGTACTGG
TACCGCAACCTACGTCAGACCGTGGAGTTCGAAGCAGCCACCCGCACTCTCCTCGACCAG
GACCACCGCTACTTCGTCGAGATCAGCCCGCACCCCGTACTCACCACCGCGATCCAGGAA
ACCCTCGACGTCACAGACACCGCCGCCGTCGCCACCGGAACCCTGCGACGCAACGAAGGC
AGCCTCCGGCGTTTCCAGCTCGCCCTTGCCGAACTCGTCACCCGTGGCCTCACCCCGCAC
TGGCCCGCCCTCTATCCCGACGCCCGCCACACGGACCTCCCCACCTATCCCTTCCAACGC
GAGCGCTACTGGGTCGGCAGCTCCTCGGTGCGGGACGCGGCGCCGGCTCCGCAACCGGAC
CCGGCAACTGGGCGAGCGGCCGGTCCGGCTTCGGGCCGGGCCGCCGTCGATGGCGGCGAC
GGGCCCGCGGAGCTGCTGGCTCTGGTGCGTGCCCACGTGGCCGTGGTGCTCGGTGAGACG
ACGCCGGACAGTGTCGATCCGAAACTGACCTTCAAGCAGCTCGGCTTCGACTCGGTCATG
TCCGTCGAGCTCCGGAACCGGCTGAGCTCCGCCACCGGATCGTCTCTGCCGAGCACAGTG
CTGTTCAACCACCCCACGCCGGACCGGCTCGCCCGCCATCTGTCCGCCGAGGCGTCCAGC
CAGGTGGAAGGCGCGCACGACGCGGCGCCGACGGGTGCCGCCGACGAGCCGATCGCGATC
GTGGGTATGGGATGCAGGTACCCCGGAGGAGTCGCGTCGCCGGAGGACTTGTGGCGGCTG
GTGACATCCGGGGGCGATGCGATCTCCGGCTTCCCCACGGACCGTGGCTGGGACCTCGAG
GTCATGTACGACCCGGACCATCGGCGGCCCGGCACCAGCAGTACCCGCGAGGGCGGGTTC
CTGTACGAGGCCGGTGACTTCGACGCCGGTTTCTTCGGCATCAGCCCGCGCGAGGCGTCG
GCCATGGACCCGCAGCAGCGCCTGCTGCTCGAGACTTCCTGGGAGGCCGTGGAACGGGCG
GGCATCGACCCGCTGTCGCTGCACGGTACGCGGGCCGGGGTTTTCGTCGGGGCCATGGCC
CAGGAGTACGGCCCGCGTCTGGACGAGGGCGCGGACGGCTATGAGGGCTTCCTGCTGACC
GGTGGCCTGACGAGCGTGTTGTCCGGGCGGCTGGCCTACAGCCTGGGGTTGGAGGGACCC
GCGGTCACCGTGGACACCGCGTGCTCGTCGTCGCTGGTCGCCGTGCACATGGCCGCCCAG
GCTCTCCGTCAGGGGCAGTGTTCCCTGGCGCTGGCAGGCGGGGTCACCGTCATGTCCGGC
CCCGGGATATTCCTGGAGTTCAGCAGGCAGAGCGGACTGGCACCGGACGGCCGCTGCAAG
GCGTTCGCGGCCGGAGCTGACGGCACGGGCTGGGCCGAAGGCGTCGGCGTGCTGGTGCTG
GAGCGGCTCTCCGACGCCCGGCGCAACGGACATCCGGTGCTGGCGGTGGTACGGGGGTCG
GCGATCAACCAGGACGGTGCCTCGAACGGCCTGACGGCACCGAACGGGCTCGCGCAGGAG
CGGGTGATCCGTGAGGCCCTGACGGACGCAGGGCTGTCTCCCGCCGACGTCGACCTGGTC
GAGGCCCACGGCACCGGCACCACCTTGGGTGACCCGATCGAGGCGCAGGCCCTGATCGCG
ACCTACGGACAGGGCCGTCCGGCGGACCGGCCGCTGCGACTGGGCTCGCTGAAGTCCAAC
ATCGGCCACGCCCAGGCGGCAGCCGGAGTGGGCGGAGTCATCAAGACGGTGATGGCGGTG
CGGCACGCAACCATGCCCCAGACCCTGCATGTCGACGCGCCGTCACCGCATGTGGACTGG
TCGTCCGGCCAGGTCCGGCTGCTGACCGAGGCAGTGCCGTGGCCCGAGTCCGACCACCCC
CGGAGGGCGGCGGTCTCGTCCTTCGGGATCAGCGGCACCAACGCTCACGTTGTCGTTGAG
CAGCCCCCGGCGGAGGTGTCCGCGGTCACCGGGCCATCACCTATGGCGCCGGACGAGGCC
GTACCGGCCCCGGGGCAGCCGGTGCCCTGGCTGCTGTCGGGCAAGTCACCGGAAGCGGTG
CGCGAGCAAGCGGCGCGGCTGCGGTCGTACCTGGCCGACCGGCCCGGCGCCGGTCTCGCC
GACATCGGCTGGTCCCTGGCGTCGACCCGGTCGGCGTTCGAGCACCGTACGGTGGTGGTC
GCGGCGGACCATGGGCAGTTCCGTGAGGCGCTGGGCGCGGCCGCGGCGGGTTCGGCGGAT
GCCCGGGTCGTCGAGGGCGTGGCCGACATCGACGGCAAGACCGTCTTCGTCTTCCCCGGC
CAGGGCGCGCAGTGGGCCGGCATGGCCGGGGAACTCCTGGACTCCTCCGAGGTGTTCGCC
GCCCGGATGGCCGACTGCGCGCGGGCTTTGGCCCCGTTCGTCGGCTGGTCGTTGCAGGAT
GTCGTCCGGCAGGCCGAGGGCGCCCCGCCGCTGGACCGGGTCGACGTCGTCCAGCCGGTG
CTGTGGGCGGTCATGGTGTCGCTGGCCGACCTATGGCGTGCTCATGGCGTTGAGCCCTCG
GCCGTGGTGGGCCACTCGCAGGGTGAGATCGCGGCCGCCTGCGTCGCCGGTGGGCTGACG
CTGGAAGACGCCGCGCGGGTGGTGTCGCTGCGGAGCCGGGCCATCGCCGAAGTACTCGCC
GGACACGGCGGCATGCTGTCGGTGACCGCGGCCCGGGAACAGGTCGAGGAGTGGCTGCTC
CCCTGGGAGGGCAGGATTTCGCTCGCAACCATCAACGGAACCGAATCCGTCGTGGTCGCC
GGCGATCCCGACGCGCTGGCGGAATTCCGCGCGTGGTTGGGGAACCGACAGATCCGTAGC
CGCACCCTGCCGGTCGATTACGCCTCTCACTCGGCGCAGGTCGAGGCTGTCCACCAGCGA
CTGCTGGACGACCTGGCGCCGATCCGCCCCCGTACGTGCCGTACCCCGCTGCTGTCCTCG
GTCACCGGCCAGTGGCTGGACACCGCCTCGATGGACGCCGAGTACTGGTACCAGAACCTG
CGCCGGACCGTGGAGTTCGCCGCGGCGACCCGCACCTTGGCCGACGGGGGGCACCGCATC
TTCATCGAGGTGAGCTCGCATCCGGTGCTGGTCGGCGCGATACGGGAAACCCTCGAAGCC
GTCGAGGTCCAGGCCGCTGTCGCCGGGTCACTCCGGCGTGACGACGGAGGCCTGCGGCGT
TTCCGGCTCTCGCTTGCCGCGCTCGTCACCCGGGGGCTGGCCCCCGACTGGTCCATGCTC
TGCCCCGGGGTGAGCCGAACCGACCTCCCCACCTACCCTTTCCAGCGCAGCCGTTACTGG
ATCACCGCCTTCTCGGGGTCGCGGAGCGCCGGTGAACTCAACGCTGCGGACTCACGCTTC
TGGGAGGCGGTCGACAGCGAGGACCCCGGGCGGCTGGCCGAGGTGCTCAGCCTCGACGAC
GACGCGTCGCTCGAACCGGTCTTCCTGGCACTGTCCTCGTGGCGGCGACGGCACCGGGTG
CGGTCCACCCTGGACGACTGGCGTTATCGGGTGACCTGGCAGCCGCTGCCCGGGGCCGCC
GTCCCGTTGACGGCGGCAACCCTCGGAGGGACCTGGCTGGTGGCCGTGCCCCACGAGGAC
GCCTACGTCTCCCAGGTGCTGCGCGGGCTGGGCGACCGCGGCGCGACCGTGATCACCCTA
CGAGCCGACGACCCGCGCCACGGCCCGCTCGCCGAGCGGGTCCGGGAGGCGCTGGCCGGA
GCGGGCGAGATCACCGGCGTGCTGTCGCTGCTGGCGTTGGACGAGCGGCCGCACCCGGAA
CATCCGGTCCTTCCCATGGGCCTGGCGCTCAACACGGCGCTGGTGCGGGCACTGGTGGAC
AAGGACGTCCGGGCTCCGTTGTGGTGCGCCACGCGGGGCGCGGTGTCGGTGGGCCGATCC
GACCGGCTGGGCAGCCCTGCCCAGGCGATGGTGTGGGGGCTCGGCCTGGTGGCGGCCCTG
GAACACCCGCGGCACTGGGGCGGGCTGGTGGATCTGCCCGAAACCGTGGACGAGCGGGTG
CTGAACCGGCTGGTGACCGTGATCTCGGGCCAACGAGTCCACGGACAGGGAGCCCCGGGC
CAGGACGGCGAAAACCCGGGCGATGAGGACCAGCTTGCGGTGCGGGCGTCCGGAGTGTTC
GCGCGGCGGCTGTCGCACGCGCCCGTGTCGGGCAGCCGCAACCGGGAGTGGACGCCCCGG
GGCACCGTGCTGGTCACCGGAGGCACCGGTGGCGCGGGCACCCAGGTGGCTCGCTGGCTG
GCCCGTAACGGCGCCGAACACCTGCTGCTGACCAGCCGTCGTGGCAGGGACGCCGAGGGG
GCCGCCGAGCTGGCGGCCGAACTCACGGAAGCCGGCGTCAGGGTCACGGTCGCCGCCTGC
GACGTAGCGGACCGGGACGCCCTGGCCCGGCTGCTCGCCGGCGTACCGGACGAGCTGCCG
CTGACCGCCGTGATTCATGCCGCCGGTGTGGTCACCACCGCCCCGCTGGACAGCACCGGT
CCGGAGGAACTGGCCGAGGTGCTGGCGGGCAAGGTGGCCGGCGCCGCCCATCTGGACGCT
CTGCTCGGCGACCGGCAGTTGGACGCCTTCGTACTGTTCTCCTCCAACGCCGGCGTGTGG
GGCAGCGGCGGGCAGGCGGCCTACGCCGCGGCCAACGCCTACCTGGACGCCCTGGCCCAG
CAGCGGTCCTCTATGGGCCAGACCGCGACCTCAGTGGCCTGGGGTGCCTGGGGCGGGGCC
GGGATGGCGGCCGAGGAAGGGTTCAAGGAGCGGCTGCGCCGGCGGGGCATCATCGAAATG
GACCCGGAGCTGGCCGTCACGGCGCTCGTGCAGGCCGTCGAGTCCGGAGAGGCGTCGATA
GCCGTTGCCGACGTCGATTGGGCACGCTTCGTGCCCGGCTTCACCTCGAACCGGCCCAGT
CCGCTGATCGGCGACCTGCCTGAGGTGCGGGACGCGCTGCGGGAGGCCGACAGCCGGCCC
GCCGTCGATCAGGGCGGGTCGGCGCTCGCCACGCGGCTGGCCGGGCTGTCCGTGCTCGAA
CGGGAGCGGGTCCTGCTCAACCTGGTGCGCACCGAGGTGGCCTCGGTACTCGGTCACACC
ACGGCCGACATGGTCGATGCCCGTCGCCCCTTCCGTGAACTCGGGTTCGACTCGCTGATC
GCGGTGGAGTTCCGCGGCCGGTTGAACGCCGCGACCGGGCTGCGGCTGCCTACCTCGGTC
GCCTTCGACCACCCCACCCCGGCCGAGCTCGCCGGCCATCTGCGGGAGTTGTTCGCCGGA
TCCCGCGGTGACACCGCCATGCCCGTGTCGGTGACCACCGCCGGGGACGACGAACCGATC
GCCATCGTAGCGATGTCCTGCCGGTACCCGGGCGGTGTGCGCACTCCGGAGGACCTGTGG
CGGCTGGTGGCCGAGGGCCGGGACGCGATCACGGACTTCCCCACCGACCGCGGCTGGGAT
ATCGAAAGCCTGTATGACCCCGACCCGGGCCGGTCCGGCACCTCCTACACCCGGCGGGGC
GGCTTCCTCGACGACGCGGCGGCCTTCGATCCGGCGTTCTTCCGGATCTCCCCCCGCGAG
GCCCTGGCCATGGACCCGCAGCAGCGGCTGCTCCTCGAAATGACGTGGGAGACCCTCGAA
CGGGCGCTCATCGACCCAACAACGCTGAAGGGCAGCCAGGCCGGGGTGTTCATCGGCACC
GCACACCCCGGCTACGGCGAGGGCATCCACCACGAGTCGCAGGGCGTCGAGGGCCAGCAG
CTGTTCGGCGGCTCGGCCGCCGTGGCCGCAGGCCGGATCGCCTACACGTTCGGCCTGGAA
GGGCCGGCGATGACGGTGGACACCATGTGCTCGTCCTCGCTGGTGGCACTCCATCTGGCC
TGCCAGTCCCTGCGCACCGGCGAGTCCTCGATGGCGCTCGCCGGCGGGGTCACGGTAATG
GCACGGCCGACCGCTTTCACCGAGTTCAGCCGGCATCGGGGACTGTCCCCCGACGGACGG
TGCAAGTCCTTCTCCGACGCCGCCGACGGCACCGGCTGGGCCGAGGGCGCCGGTGTGCTC
CTTCTCGAACGGCTCTCCGACGCCCGTCGAAACGGCCACCCCGTGCTGGCCGTCATCCGC
GGCAGCGCCATCAACCAGGACGGCGCCAGCAACGGCCTTACCGCACCCAACGGCCCCTCC
CAGCAACGCGTCATCCAGCAGGCCCTGGCGAACGCGTCCCTGTCGCCGGCCGACGTCGCC
GCCGTCGAGGCCCACGGCACCGGTACCACCCTGGGCGACCCGATCGAGGCCCAGGCCCTG
ATCGCCGCCTACGGACAGGACCGCCCGACGGACCGGCCGCTACGGCTGGGCTCGCTGAAG
TCCAACATCGGCCACGCGCAGTCCGCAGCCGCAGTCGGCGGCGTGATCAAGATGGTCCAG
GCCATCCGGCACGGCCTCCTCCCGCGCACGCTGCACGCGGAGCAGCCCTCCCGCCACGTG
GACTGGTCCGCCGGCTCGGTGGAACTGCTCACCGAGGCGATGCCGTGGCCGGACAACGAC
CAACCCCGGCGGGCGGGTGTCTCGGCGTTCGGCGGCAGCGGCACCAACGCCCACATGATC
ATCGAGCAGGCGCCCGCGCCGGACGAGCCGGAGCACACCGACGGCACGAGCAGGACCAGC
GGCGAGAGCGGCGCCGAACAGGCCAGGCCGCTGCCGATGGTGCCCTGGGTGCTGTCCGCG
CGGAGTGACACCGCGCTGCGGGCACAGGCCCGGCGCCTGCGCGCCTACGCGGCCGCCGCC
GAGGCGGGCAGCATCTGCGACATCGGGTGGGCGCTGGCGACCACCCGAGCCACGCTGGAC
GACCGGGCCGTGGTCGTGGCCGCGGAACGGGAAGGATTCCTCACCGCTCTCGACGCGCTG
GCCGAGGACCGGACCGCCCCCGGTCTGGTCCGGGGGGCGGCTGGAACAGGAGTGCGGTCG
GCATTCCTGTTCTCCGGCCAGGGCTCACAAAGACTCGGCATGGGGCGCGAGCTGTACGAC
ACGTCCCTCGTGTTCGCCGAGGCGCTGGACGAGGTGTGCGCCCAGCTCGACGGGCACCTG
GACCGGCCCCTCCTGCGGGTGCTGTTCGCGGCGGAGGGTTCCGACGACGCGTCGATGCTG
GACCAGACCGCCTTCACCCAGGCCGCGTTGTTCGCGGTCGAGGTGGCGCTGTTCCGCCTC
GTCTGGTCCTGGGGCCTGCGGCCCGATTTCCTCATCGGGCATTCCGTGGGCGAAGTCGCG
GCCGCCCATGTCTCGGGCGTGCTGTCCCTCGCCGACGCCGCGACACTGGTGGTCGCCCGC
GGTCGGCTGATGCAGGCGTTGCCCTCCGGCGGCGCGATGGTGGCCTTGCAAGCGGGTGAG
GAGGAAGTACGGCTGTCCCTGGCGGGACTGGAGGACGTTGTCGGCGTCGCCGCCCTCAAC
GGCCCCGCCTCGACCGTGATCTCTGGCGACGAGGAGGCCGTCCTCCCGGTGGCCGCGCAC
TGGCGCGCGCAGGGCCGCAAGACGCGTCGCCTCAAGGTGAGCCACGCCTTCCACTCACCC
CGTATGGAACCCATGTTGCACCGGTTCCACGCCGTGCTCAAAACGCTTTCCTTCGCCGAG
CCGGCCATTCCCGTGGTCTCGAATGTGACCGGCCGTCCCGCCGAGCGGACCGAACTGTGC
GCGGCGGACTACTGGGTGCGCCATGTCCGGCATACGGTGCGCTTCCATGACGGCATCCGC
GCGCTGGAGGCCGAAGGCGTCAGCGCATTCCTGGAGTTGGGGCCCGACGGCACACTCTCG
GCGATGGTCCGCGACTGCCTGGACACCAGCCGCCCGGTGGTCACGGCACCGGTTTTGCGA
CGTGACCGTACCGATGTGTCTGCCGCGTTGACGGCACTGGCCGAAGCGCACGGGCACGGG
GTGCCGGTGGACTGGGCGTCGCTCTTCGCCGGCTCGACCGCCCGGGCGGTCGAGCTGCCG
ACGTACCCGTTCCAGCGGGAACACTTCTGGCTGGATTCCGTCACGGGCAGCAGTGACATG
AGCACGGCCGGACTGGCGTCCCCCGATCATCCGCTGTTGGGAGCCGTGACGACGGTGGCC
GGCGAGGACGGCCTCCTCTTCACCGGCAACCTGTCGGTACGGACGCACCCATGGCTGGCC
GACCACAGGATCACCGGTTCGGTCCTGCTGCCCGGCACGGCGTTCCTGGAACTGGCCGTC
CAGGCCGGGGACCAGGCCGGCTGCGGGCGGGTCGAGGACCTGACGCTGCTGGCTCCGCTC
GTACTGCCCGAAGAGGGCAGCGTCAGGGTCCAGATGAAGGTGGGGGAGCCCGACGCCACG
GGCCGCCGCACCATCGAGGTGTACTCCTCGGACCAGCAGGCCCCCGGCCGGGAACGCTGG
GTCCTCAACGCGAGCGGGATGCTTGCCGGCGAACCGGTGGAGGCCCCGCCGAGTCTCACC
ACCTGGCCCCCGGAAGGCGCTGTCCCCGTTCCGCTGGACGGCTTCCACGACCGGCTGGCG
GCACGCGGCTACGGCTACGGCCCGACATTCCGCGGGCTGAGCGCCGCGTGGTCACGCGGT
GACGAGATCTTCGCCGAAGCGGCGCTCCCCTCGGGCCATCGGCAGGATGCCGCCCGCTAT
GGACTCCACCCCGCCCTACTCGACGCTGCCCTGCACGCCATGGAACTCCGGGAACCCCGC
CCGGCCGGCGACGGAGTCCGGCTTCCGTTCGCCTGGAACGGCTTCTCCCTGCACGCGTCG
GGTGCCGAAGCGGTACGGCTGCGCCTCGCGCCGACGGGCGCCGACGCTCTGTCGGTGACC
CTCGCCGATGCCATCGGTCGCCCGGTTGCCTCAGCCCGCTCGCTGGCCCTGCGGGAGCTC
TCGTCCGACCTGCTGCGCCCGGCGTCCGTCTCGTACGGGGACTCGCTGTTCCGCACCGCT
TGGATACCCGCCCTCGTCGGCCCGGAGGCGGAGTCCGGGCCGGTGCGACCGTCCGCCGGC
TGGGCGGTGCTGGGCCCCGATCCGCTCGGCGCGGCCAACGCCCTGAACCTCACGGGAACC
TCCTGCTCCTGCTATCCGGACCTGGCGGCGCTGATCGCGGCCGTCGACGGCGGAGCCGCG
GTGCCCGAGGCCGTACTCGCGCCGTACGCGGCGGAGCCAGCCCCGGACGCGGGATCTCCC
GCGGACGCCGTACGGGCCTCGACCGGCCGGGCGCTGCAACTGCTGCAATCCTGGCTGTCC
GAGGACCGGTTGGAGCGAAGCCGGCTGATCGTGCTCACCCGGGGGGCGGTGGCCGTCGGT
ACGGACGAAGGCGTCACCGACCTGGTGAGTGCGTCGGTCCGGGGTCTGGTCCGTTCGGCG
CAGGCCGAGCACCCTGGCAGGTTCTCCCTGGTCGACATCGACGACCGGGAGGAGTCCTGG
GCCGTCCTGAGCGCGGCGGCGGTATCCGATGAGCCACAACTCGCCCTGCGCTGCGGCCAG
ATGAAGGTGCCCCGCCTCGGCTCCGTCGACGTTCCCACGACCGGTATGCCTGAGATGCCC
GACGTTTGGGGTGTTGACGGTACCGTGTTGATCACTGGCGGGACCGGTGTGCTGGGTGGG
CTCGTCGCCCGTCATCTGGTCGCCGGGCATGGGGTCCGTCGTCTGTTGCTCTGCAGCAGG
CGGGGCCCTGATGCGCCGGGTGCGGTGGAGCTGGTCGCCGAGCTCACCGCTCTGGGTGCG
GATGTCACCGTTGCCGCCTGCGACGCGGCCGACCGGGATGCGCTGGCCGCGCTCTTGGAC
ACCGTTCCCGCCACGCACCCTCTGACTGGTGTCGTGCATACCGCTGGTGTCATCGATGAC
GCCACTGTCACCACCCTCACTCCCGAGCGCATCGACGCGGTCCTACGCCCCAAGGTCGAC
GCCGCGCTCAACCTCCATCAGCTGACGGCGCATCTCGGCTTGACCCGCTTTGTGCTCTTC
TCCTCCGCCGCCGGGCTCTTCGGCGGCGCGGGCCAGGGTAACTACGCGGCCGCCAACGCC
TTCCTCGACGCACTGGCCCAACACCGGCGGGCCAACGGCCTCAATGCCCAGTCCCTGGCG
TGGGGACTGTGGGCGGAAGCCAGCGGGATGACCGGGCACCTGGACGCGGCCGACCTCGCC
CGGGTGGCCCGTTCCGGCCTCACCGCGATGCCCACCGGGGACGGGCTGGCGCTGCTCGAC
ACCGCTCAGCGGGTGGACGAAGCCACCCTGGTCACGGCCGCGCTGGACACCCGGGCCCTG
CATGCCCGGGCCGCAGACGGCACGCTGCCGGCGCTGTTCCACGCACTCGTGCCCGTACCG
CGCCGATCCGCGACCTCCCCGGCGGCCCAGGCCGCGGGGCCGGATGGACTCCGCCAGCGG
TTGTCGGGGTTGGTCGAGGGGGAGCGTCGAGCGGCGCTGCTGGATTTGGTGTGTGGTCAT
GTCGCGAGGGTGCTGGGGCACGCGGACCCGAGCAGCATTGAGGAGACCCGGCCCTTCAAG
GACACCGGCTTCGACTCATTGACCGCTGTGGAGCTGCGCAATGTGCTGCACGGTGCGACC
GGGTTGCGGCTGCCGGCCACGCTGGTCTTCGACTACCCGACGCCTGCAGCTCTCACCGAT
CACCTCTACGACGAGCTTCTGGGTTCCCGCGAGGACGCCGTGCTCGCCCCGATCACCAGG
GCCGCGTACGACGAGCCGATCGCGATCGTGGGGATGGCCTGCCGCTATCCGGGCGGGGTG
GAGTCCCCGGAGGACCTGTGGCAGCTGGTCGCCGACGGCCGTGACGCCATCTCCGACTTC
CCCGCCGACCGGGGCTGGAACGTCGAGAGCCTCTACCACCCCGACCCCGACCACCCCGGC
ACCAGCTACACCCGTGCCGGAGGCTTCCTGCACGACGCGGCGGACTTCGACCCGGAGTTC
TTCGGGATCTCACCGCGTGAGGCACTGGCCACCGACCCCCAGCAGCGACTGCTGCTGGAG
ACGACGTGGGAGGCCTTCGAACACGCCGGGGTCGGCCCGGCGTCACTGCGTGGCAGCCGG
ACCGGCGTCTTCGTCGGCGTGATGTACAACGACTACGCCTCGCGTATCCGGCACATCCCA
GAGAGCGTCGAGGGCGGTCTGACCACCAACAGCGCGGGGAGTGTGGCGTCGGGCCGGGTC
TCGTACACGTTCGGTCTGGAGGGACCGGCCGTCACGGTGGATACCGCGTGTTCGTCGTCG
CTGGTGGCGTTGCATCTGGCCGCGCAGGCGTTGCGCAACGGTGAGTGCACTCTGGCTCTG
GCGGGCGGTGTTGCGGTGATGTCCACTCCTGCCACGTTTGTCGAGTTCAGCCGGCAGCGG
GGGCTGGCAGCTGATGGGCGGTGCAAAGCCTTCGCGGACGCTGCCGACGGCACCGGCTGG
GGCGAAGGCGTCGGTGTGCTGCTGGTGGAGCGTTTGTCGGACGCGCGCCGCAACGGGCAT
CCGGTGCTGGCGGTCGTTTCGGGCAGTGCTGTCAACCAGGACGGGGCCAGCAATGGTCTG
ACGGCGCCCAATGGTCCTTCGCAGCAACGGGTGATCCAACAGGCGCTGGCCAATGCGGGG
TTGGCGGGGGCGGATGTCGATGCCGTGGAGGCGCACGGCACGGGAACCCGGCTGGGCGAC
CCGATCGAGGCGCAAGCGTTGATCGCCACCTACGGACAGGCCCGGTCGGCGGACCGGCCG
TTGTGGCTGGGTTCGCTGAAGTCCAACATCGGTCACACCCAGGCCGCCGCGGGCGTCGCC
GGCGTCATCAAAATGGTGCAGGCGATGCAGCACGGGACTCTGCCGCCCACCCTGCACATC
GACCAGCCCACGGGCCAGGTCGACTGGGCTACGGGTGCAGTGGAGCTGCTGACCGAGGCC
GTGCCCTGGCCGGACAGTGACCGGCCCCGCCGGGTGGCTGTCTCCTCGTTCGGTGTCAGC
GGTACCAACGCCCACGTCATCATCGAACACACCCCACACACCCCACACACCACCCGCACC
TCCCAATCCTCCCAATCCCCCCAGGCCCCGCAGACTGTGCAGGCCCATCGGCCGGTGCCG
TGGCTGCTGTCGGCGAAGACCTCGCAGGCCCTGGCCGCGCAGGCCCGGCGCCTGTCAGCT
CACTTGCGAGCCAACCCCGATCTGCGTTCGGCTGATGTGGCGCATTCCCTGCTCACCACG
CGGTCTGTCCACGCCGAGCGCGCCGTCTTCATCGCCGGTGACCGGGATGAGGCTCTTGCC
GCCCTGGACGCACTGGCCGACGGCACCCCTGCCCCTCACCTCGTTCAGGGCCTTGCCGAT
GTGAGTGGCAAGACGGTGTTCGTCTTCCCCGGTCAGGGTTCGCAGTGGGTGGGTATGGCC
GTTGAGCTGCTGGACGGCTCGGAGGTTTTCGCCGAGCATATGGCCGCCTGCGCCAGGGCC
CTGGAACCGTTTGTGGACTGGTCCCTGGAGGACGTCCTACGCCAGACGGACGGTACGTGG
CCACTGGAACGCGTCGAAGTGGTCCAGCCCGTGCTGTGGGCGGTCATGGTCTCGCTCGCG
GGACTGTGGCAGGCACATGGCGTTGAGCCTGCTGCGGTGCTGGGCCACTCCCAAGGTGAG
ATCGCTGCGGCTTGCGTGGCGGGAGCCCTGAGTCTGGAAGACGGAGCCCGCGTTGTCGCG
CTTCGCAGCCAAGCCATCGCCGAAACCCTCGCAGGACACGGCGGAATGCTCTCAATCGCC
GCCCCCGCCACCGACATCGCACCCCTGATCGCCCGCTGGAACGAGCGGATCTCCATCGCC
ACGGTCAACGGACCGCATTCGGTGGTGGTCGCAGGAGACCCTGACGCGCTCGAGGCACTC
CGCGGCGAACTGGAGACCCGTGGTCTCCGCAATCGTCGCATCCCGGTCGACTACGCCTCA
CACACCCCTCACGTCGAGGCGATCCGTGAACGGCTCCTGGCCGACCTGGCAGTGATCCAG
CCACGTGCCGCGAGCATTCCCGTGCTGTCCACCGTCACCGGCGCATGGCTCGACACCACC
GTGATGGACGCCGAGTACTGGTACCGCAACCTACGTCAGACCGTGGAGTTCGAAGCAGCC
ACCCGCACTCTCCTCGACCAGGACCACCGCTACTTCGTCGAGATCAGCCCGCACCCCGTA
CTCACCATCGGTCTACAGCAGACCATCGAGGAAACCACCGCTCCGGCCCGGACCCTCTCC
ACCCTCCGACGCAACGAAGGCACCCTCCGGCACCTGTTCACTTCCCTCGCCCAGGCCCAC
GCCCACGGCCTGACCATCGACTGGACCCCCGCCTTCACCCACACCGAGCCCCGCACCACC
CCCCTGCCCACCTACCCCTTCCAACACGAACGCTACTGGCTGGAGGACGGAGCTCCGAAG
TCCGGGGACGTGGCTTCGGCCGGACTCGGCTCGGCGGACCATCCGCTGCTGGGCGCCGCT
GTGCCGCTGCCCGATTCCGGGGGCTTCCTGTTCACCGGCCAGTTGTCGCTGCGGAGTCAC
CCCTGGTTCGCCGACCACGCGGTACACGGCACCGTGCTGCTGCCGGGCACCGCGTTCGTG
GAACTGGCGCTCCAGGCCGGTGGCCGTCTCGGCTGCGGGCTGCTGGAGGAACTCACCCTG
GAGGCACCGCTGGTGCTGCCGGAAAACAGCTCCGTCCAGCTCCAACTCGTGGTGAACGCC
CCGGACGCCCAGGACGACTCGGGCGGCAGGACCTTCAGCGTGTACTCGCGCCCGCAGGAC
CGTACTGCGGACGCGCCCTGGGTGCGGCACGCCACCGGAGTGGTCCGGTCCGGAGGCGCG
CCGGAGCCGGAGGGACTGACCGTGTGGCCGCCGACCGGAGCGGTCGCGGTGCCGGTCGAG
GACTTCTACCAGGTGCTCGGTGACCGTGGCTATGACTACGGACCTGCGTTCCGTGGGGTA
AGGGCCGCGTGGCGCCACGGTGACGTGGTGTATGCCGAGGCCGCACTGGCCGAGGAGCAG
CAGTCGGACGCCGCGCTGTTCCACCTCCACCCGGCCCTGCTCGACTCGGCGCTGCACGGG
ATGGGACTGATGCCCTCGGCGAGCGCGGAGCAGACCCGGCTGCCGTTCGCGTGGCGCGGT
GTGACGCTGCATGCGGTGGGGGCGTCGGCCCTTCGGGTGAGTCTTAGGCCCGCCGGGCCC
GACACGGTGGAGGTCCTACTGGCCGATGGCGCAGGTCGGCCGGTCGCTTCGGCCGACGCA
CTGGTGGTCCGGCCGCTCCGACAGGAGGAACTGGCGGTCTGGCAGGACGCGTACCGCGAC
TGGCTGTACCGGGTCGACTGGCCCGAGTTGCCGGAGGTCCCCCTGGTGGCTCCGGCCGGG
CCATGGGCCGTCCTGGGCGGGAACGCCGGCGGGATACTCGGCACCGATGGCTCGGCCGGG
TTGCTGGCCGGGGTCCCGATCGACGCCTATCGGGACCTGGCGGAGCTGCGCGACCGGACG
GGCCCGAGCAGCGCGTTCCCGGCCGTGGTGGTCGCGCCGGTCGCCACGGGAACCGGTGCC
GCGCCGGACGCGGTGCGGGAGGTGACGTACCAGGTGCTGGACATGATCCAGTCATGGCTC
GCCGACGATCGTTCCGCCTCGTCGACCCTTCTCCTGGTGACCCGCGGCGCGGTGTCCACC
GGCTTCGGGGACGACCTGGTCGATCTGGGGCAGGCGGCGGTATGGGGGTTGGTGAGGGCC
GCGCAGTCGGAGAACCCGGACCGCTTCGTCCTCCTCGACCTCGACGGGAGCGAGCCGGTC
GGGCCTCTCCCGACGGCGGCGCTGCTCTCCGGGGAGCCGCAACTGGCGTTCCGGGAGGGC
AAGGTGCTGACCGCCCGGCTGGACCGGGTGTCGTCCGACGCGGGAACGCTGCTGCCGCCC
GCCGGGCCGGACCCGTGGCGACTCGACGTCACCAGCCGGGGCACGCTCGACAACCTCGCG
CTCCTCGCGGCGCCGCAGGTGTCGGCGCCGCTCGCCGAGGGACAGGTCCGGGTCGCGGTG
CACGCGGCCGGCCTGAACTTCCGCGATGTGCTGGTCGCTCTGGGCATGTACCCGGGTGAG
GGTTCGATGGGCAGCGAAGGCGCCGGCGTGGTGCTGGAGGTCGGGCCCGGCGTTGAGCGG
CTGGCCCCGGGCGACCGGGTGATGGGCATGCTCGCGGGCGGCTTCTTCGGGCCGGTCGCC
GTAACCGACCAGCGCATGGTGACCAAGCTTCCGGACGGCTGGTCGTTCACCGAGGGCGCA
TCGGTACCGATCGTCTTCCTCACCGCGTACTACGGACTGGTCGACCTGGGCGGCCTGCGC
GCCGGCCAGTCGCTGCTGGTGCATGCGGCGACCGGTGGTGTGGGAATGGCGGCTACGCAG
CTGGCCCGGCACCTCGGCGCTGAGGTGTTCGGCACGGCGAGCCCCGGCAAGTGGGAGGCG
CTGCGGGGGATGGGATTGGACGAGGAGCACATCGCCTCGTCGCGGGACCTGGACTTCGAG
AAGAAGTTCTCGGCCGCGACCGGTGGCCGCGGTGTCGACGTGGTGCTGAACTCGCTGGCC
CGGGAGTTCGTGGACGCGTCGCTGCGGCTGCTGCCGCGCGGCGGTCGATTCGTGGAGATG
GGCAAGACCGACATCCGTGACGCCGAGGCGGTTGCCGCCGGGCATCCCGGCGTCGTCTAC
CGGGCCTTCGACCTGCTGGACGCCGCGGGGCCGGACCGTATCCAGGAGATGCTGGCCGAG
TTGCTCGCGCTCTTCGAGGCGGGGGTGATCGAGCCGCTGCCGCTGACGACCTGGGACATC
CGGCGTGCCCCGGAGGCGCTGCGGCACCTGAGCCAGGCACGGCACATCGGCAAGATGGTC
TTCACCCTGCCGCCCGCCCCGGACCCGGACGGTACGTTCCTGATCACGGGTGTGCCCGGA
GCGCTGGGCAACCTGGTCGCCCGCCATCTGGTGACCGAGGGTGGCATACGGAACCTGCTG
CTCGTCAGCCGCCGGGGGCCGGCGGCCCCCGGCGCGGAGGGGCTGGCCACCGAGCTGGCC
GGGCTGGGGGCGACGGTGACCCTGGCGGCCTGTGACGTGGCCGACCGCCAGGCCCTGGCC
GGGCTGCTCGCCGACATCCCGGCGGAGCATCCGCTGACGGGTGTGGTGCACGCCGCCGGT
GTGCTGGACGACGGGATCGTGGCATCCCTGACCCGCGAACGGCTGGACGCGGTCTACCGC
CCCAAGGTGGACGCCGCCTGGAACCTGCACGAGCTGACCAAGGACAGCGGCCTGGCCGCG
TTCGTACTGTTCTCCTCGGCCGCCGCGACGCTCGGCAGCGCAGGCCAGGGCAACTATGCA
GCGGCCAACGCCTTCCTCGACGCCTTGGCCCAATTCCGCCAGGCCCAGGGCCTGGCGGCC
AGCTCCCTCGGCTGGGGATTCTGGGCCGAGAGCGGTGAGATGACCGGTCACCTGGGGGCC
TCCGACCTGGCACGGATGGCACGTTCGGGCATCGCCGCCCTGACGGTCGAGCAGGGCCTG
GCCCTGTTCGACTCCGCACGGTCGGGTGTCTGTGCGTCAGTGCTGCCGGTACGGCTGGAA
CTCACCGGGCCCGGTGCGCGGGCCGGGTCGGGAACGGTGCCGGCGCTGATGCGGGGGCTG
GTGCGGGCACCGGCCCGGCGGGTGGTGGAAACAACCACGGGCGGTGCCGTCACAGGCCTG
CGCCAACGGCTGGCGCCGCTGTCCGGCGCGGACCGCGACCGCGCCCTCCAAGAGCTGGTG
TGCTCGCATGCGGCCACCGTGCTGGGGCACAGCCGTTCCGGATCGGTGCCCGCGCAGCGG
GCGTTCAAGGAGCTCGGCTTCGATTCGCTGACAGCCGTCGAGTTGCGCAACCGGCTCAAC
GTGGCGACCGGCCTCCGGCTCCCCGCGACTCTGGTGTTCGACCACCCGACCCCGCTGGCG
ATGGCGGAACAGCTCCGGAAGGAGCTGTTCGCGGACGAGATCCCGGTGGCGCCGCAGGTT
TTGGAGGAACTGGACCGTCTGGAGGCGGCGTTCGCCGTCTCCTCCGCCGGCGACCTCCAG
CAGTCGGGAGCCGCGGCACGGCTGAGGGCACTGCTGAGGCGGATCGGCACCGTCACTCCG
GCGGGAGGGGACGCTGCCGACGGCCTCGCCGTAGAGCTCGAAACAGCCACCCACGACGAG
ATCTTCGCCCTTATCGACGAGGAGGTAGGGGACGTGTGA
[0] KSQ7..381
[0] AT539..857
[0] methylmalonyl-CoA not conserved YASHS(S->T)731..735
[0] ACP925..995
[1] KS1015..1392
[1] AT1555..1874
[1] methylmalonyl-CoA1747..1751
[1] KR2201..2380
[1] ACP2485..2555
[2] KS2577..2953
[2] AT3122..3442
[2] malonyl-CoA3315..3319
[2] DH3490..3653
[2] KR3987..4167
[2] ACP4273..4343
[3] KS4364..4741
[3] AT4906..5224
[3] methylmalonyl-CoA not conserved YASHS(S->T)5098..5102
[3] DH5274..5440
[3] ER5774..6081
[3] KR6091..6271
[3] ACP6376..6446
[0] KSQ19..1143
[0] AT1615..2571
[0] methylmalonyl-CoA not conserved YASHS(S->T)2191..2205
[0] ACP2773..2985
[1] KS3043..4176
[1] AT4663..5622
[1] methylmalonyl-CoA5239..5253
[1] KR6601..7140
[1] ACP7453..7665
[2] KS7729..8859
[2] AT9364..10326
[2] malonyl-CoA9943..9957
[2] DH10468..10959
[2] KR11959..12501
[2] ACP12817..13029
[3] KS13090..14223
[3] AT14716..15672
[3] methylmalonyl-CoA not conserved YASHS(S->T)15292..15306
[3] DH15820..16320
[3] ER17320..18243
[3] KR18271..18813
[3] ACP19126..19338

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [534-662]  G3DSA:3.40.366.10 [731-845]  G3DSA:3.40.366.10 [1551-1678]  G3DSA:3.40.366.10 [1747-1861]  G3DSA:3.40.366.10 [3115-3247]  G3DSA:3.40.366.10 [3315-3432]  G3DSA:3.40.366.10 [4902-5029]  G3DSA:3.40.366.10 [5098-5214]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [953-968]  PS00012 [6404-6419]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [924-997]  1.60000000000002e-87 G3DSA:1.10.1200.10 [2485-2557]  1.60000000000002e-87 G3DSA:1.10.1200.10 [4271-4346]  1.60000000000002e-87 G3DSA:1.10.1200.10 [6375-6449]  1.60000000000002e-87 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [925-995]  PS50075 [2485-2555]  PS50075 [4273-4343]  PS50075 [6376-6446]  PS50075
PS50075   ACP_DOMAIN
 [929-994]  1.4e-11 PF00550 [2488-2554]  9.30000000000002e-14 PF00550 [4276-4342]  1.7e-11 PF00550 [6380-6444]  7.5e-10 PF00550
PF00550   PP-binding
 [923-1032]  3.1999989904635e-26 SSF47336 [2478-2594]  5.39999384454126e-29 SSF47336 [4266-4381]  8.70001261213513e-30 SSF47336 [6368-6463]  3.00000067992871e-21 SSF47336
SSF47336   ACP_like
IPR011032 GroES-like (Domain)
 [5765-5909]  7.10001443313147e-31 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [5913-6008]  1.4e-18 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [5794-5849]  4e-07 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [2201-2379]  2.89999999999999e-63 PF08659 [3987-4166]  3.5e-63 PF08659 [6091-6270]  1.40000000000001e-61 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [7-256]  3.49999999999995e-91 PF00109 [1015-1266]  2.20000000000002e-95 PF00109 [2577-2828]  3.30000000000002e-95 PF00109 [4364-4615]  2.20000000000002e-101 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [264-381]  8.89999999999994e-42 PF02801 [1274-1392]  3.80000000000003e-45 PF02801 [2836-2953]  4.5e-44 PF02801 [4623-4741]  1.80000000000002e-48 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [539-857]  3.99999999999998e-104 PF00698 [1555-1874]  5.99999999999995e-104 PF00698 [3122-3442]  1.60000000000002e-70 PF00698 [4906-5224]  1.20000000000001e-104 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [537-840]  8.89993011983204e-69 SSF52151 [1553-1845]  3.39999972437719e-65 SSF52151 [3119-3426]  1.19999063421924e-72 SSF52151 [4904-5207]  8.29994113369276e-67 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [665-730]  1e-17 SSF55048 [1681-1746]  3.59999643435987e-16 SSF55048 [3249-3314]  3.60000433965927e-18 SSF55048 [5032-5097]  4.09999599045784e-18 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [9-268]  G3DSA:3.40.47.10 [269-433]  G3DSA:3.40.47.10 [1018-1278]  G3DSA:3.40.47.10 [1279-1444]  G3DSA:3.40.47.10 [2580-2840]  G3DSA:3.40.47.10 [2841-3006]  G3DSA:3.40.47.10 [4364-4626]  G3DSA:3.40.47.10 [4627-4793]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [6-431]  2.7000136937899e-95 SSF53901 [1008-1390]  1.90000694315261e-99 SSF53901 [2570-2952]  2.99998750445706e-100 SSF53901 [4357-4793]  3.10001307370203e-105 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [2201-2386]  3.30000000000002e-115 G3DSA:3.40.50.720 [3987-4196]  3.30000000000002e-115 G3DSA:3.40.50.720 [5865-6057]  2.99999999999998e-56 G3DSA:3.40.50.720 [6092-6272]  3.30000000000002e-115 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [1179-1195]  PS00606 [4528-4544]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [541-839]  1.3000049540733e-119 SM00827 [1557-1855]  1.09999184471405e-115 SM00827 [3123-3423]  4.19996082218455e-130 SM00827 [4908-5206]  2.80000504261099e-119 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [926-998]  1.50000306971104e-31 SM00823 [2486-2558]  2.19999900980707e-33 SM00823 [4274-4346]  1.40000506907309e-34 SM00823 [6377-6449]  1.40000506907309e-33 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [3490-3653]  3.60002015031011e-83 SM00826 [5274-5440]  8.00002659346736e-88 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [9-434]  SM00825 [1018-1444]  SM00825 [2580-3006]  SM00825 [4367-4793]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [2201-2380]  1.99999636034521e-55 SM00822 [3987-4167]  6.39998633403535e-63 SM00822 [6091-6271]  2.39999798157265e-54 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [5774-6081]  SM00829
SM00829   PKS_ER
SignalP
 [1-24]  0.17 Signal
Eukaryota   
TMHMM No significant hit
first first   Pladi_00020 Pladi_00020