close all open/close all

CDS information : Pladi_00020


close this sectionLocation

Organism
StrainMer-11107
Entry namePladienolide
Contig
Start / Stop / Direction28,021 / 49,101 / + [in whole cluster]
28,021 / 49,101 / + [in contig]
Location28021..49101 [in whole cluster]
28021..49101 [in contig]
TypeCDS
Length21,081 bp (7,026 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase
Gene
Gene (GenBank)pldAII
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18997414] Organization of the biosynthetic gene cluster for the polyketide antitumor macrolide, pladienolide, in Streptomyces platensis Mer-11107. (Biosci Biotechnol Biochem. , 2008)

close this sectionPKS/NRPS Module

4 malonyl-CoA
5 methylmalonyl-CoA
not conserved YASHS(S->T)
6 methylmalonyl-CoA
not conserved YASHS(S->T)
7 malonyl-CoA
KS38..413
AT590..913
DH979..1142
KR1465..1645
ACP1749..1819
KS1840..2217
AT2383..2701
DH2749..2912
KR3246..3426
ACP3532..3602
KS3661..4038
AT4203..4521
KR4844..5019
ACP5126..5196
KS5222..5599
AT5757..6076
DH6125..6294
KR6621..6801
ACP6905..6975

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase]
MPKTETTEEKLFSYLKKATSELQQSRRRVAELEAAEAEPIAIVGTACRYPGGVRSPEDLW
RLVAEGQHAISSFPTDRGWDLEDLYDPDPDRPGKSYARDGGFLDGAAQFDAAFFGISPRE
ALAMDPQQRLLLETTWEVFERAGIDPTSLRGSRTGVFAGISHQDYAAGQRPSAEVSEGHL
MTGTAVSVVSGRVAYAFGLEGPAMTVDTACSSSLVALHLAAQALRNGECTLAVAGGVTVM
ATPGAFTRFSRERGLAPDGRCKAFSSDADGTGFSEGVGVLLVERLSDARRNGHPVLAVVS
GSAVNQDGASNGLTAPNGPSQQRVIQQALANAGLAGADVDAVEAHGTGTRLGDPIEAQAL
IATYGQARSADRPLWLGSLKSNIGHTQAAAGVAGVIKMIQAMGHGTLPRTLHVNQPSPQV
DWAAGAVELLTEAMPWPEGDRPRRAGISSFGISGTNAHVIIEQGAPPRTASDPGESRADE
PGVRGGAPVPATTESATEPQPVPWLLSGHSATALRAQADRLKSYAANNTGIRPADIGFSL
VTTRAALEHRAVVVAADHAGFTAGLDALAEGRTAPGVVSGTVVAGARSAFLFSGQGSQRV
GMGRELQQAFPVFAEAFEAVCAQVDPYLEHPLLDVVLAAPDSDFGALLHQTAYTQPALFA
LEVALFRLVESWGVRPDYVAGHSVGEIAAAHVAGVFSLEDAARLVVARGQLMQALPAEGA
MVALQVSEDEVLPSLTPWLEQDRVDVAAVNGAASTVVSGDEEAVLAVAEHWQARGRKVRR
LTVSHAFHSPRMDPMLDQFRVVVEGIRFAEPAIPVVSSVTGRLAEPGQLTTADYWVRHVR
QTVRFHDALQTLQTENVTAFLEIGPDGQLSAMTRDFLTDTGAHAAVAPLLRRERPEAPSA
LTAIAGLHTHGVSIDWRTYFTSTSTSTSTSTGTGTGTGQATADTPVQLPTYAFQHQSFWL
GPTAPVGDVSTAGLTSPDHPLLSAATTTAVDGSLLLTGRLSQRSPAWIGDHRIGGVVLLP
GTALVELVVRAGDQAGCSRIDELIMLTPLTLPEHGAVRIQVAVGGPAHDGRRPVHIHSST
SDTTGDEQWTLNASGLLTVEMTDPPADLTPWPPQHATRIPLDGLYERLAESGYGYGPVFQ
GLRAAWTLGDDTYAEVEIPAGDQTDTDRYELHPALLDAALHASSLQGDEAGAGQLLPFAW
TGVSLYAAGASALLVKVSRTGPDTMALLVADTEGHPVATVDSLTVRPMAIDQTARSTSHP
DALFTVGLEWAQAREGNRTIPLSDCAMLAPDEPDLTSAPAWPGSSAQRYAGLAALAEICG
TDGPVPAVVLAPFLPGDAAPADTAAATHATTRRAAALIKGWLGDDRFTDSRLVFVTRGAV
ATSGRDELHDLEHSTVWGLVRSAQTENPGRFALLDLDDPDTVTELPEAILADQAQLVLRD
GRLGNLRLAKGAAIQDPDPGWGVDGTVLITGGTGVLGGLVARHLVAGHGVRRLLLCSRRG
PDAPGAVELVAELTALGADVTVAACDAADRDALAALLDTVPATHPLTGVVHTAGVIDDAT
VTTLTPERIDAVLRPKVDAALNLHQLTAHLGLTRFVLFSSAAGLFGGAGQGNYAAANAFL
DALAQLRKRQGLPGVSLAWGAWVQDGGMTATLDAGDVERMARGGVLPLSHEQGLNLFDLA
VAGSEPLVAPMRLDTTALRESGATVPEMLRGLVRERSRRRVGPSHTTSAAMALEQRLSGL
VEGERRAALLDLVCGHVARVLGHADPSSIEETRPFKDTGFDSLTAVELRNVLHGATGLRL
PATLVFDYPTPAALTDHLYDELLGSREDAVLAPITRAAYDEPIAIVAMSCRYPGGVCTPE
DLWRLVAEGRDTITDFPDDRGWDIDALYDPDPGHPGTSYTRRGGFLSDAAGFDPAFFRIS
PREALAMDPQQRLLLEMTWEMFERALIDPTTLKGSQAGVFIGTAGPGYGGRIHHESQGVE
GQQLFGGSAAVTSGRISYTFGLEGPAMTVDTMCSSSLVALHLAVQSLRNGESSMALAGGV
TVMSRPAAFTEFSRQRGLSPDGRCKSFADAADGTGWGEGAGVLLLERLSDARRNGHPVLA
VIRGSAVNQDGASNGLTAPNGPSQQRVIRQALANASLSPADVDAVEAHGTGTPLGDPIEA
QALIATYGQDRPADRPLRLGSVKSNIAHAQAAAAVGGVIKMVQAIRHGLLPKTLHVEQPS
RHVDWSAGSVELLTEAMPWPETDQPRRAGVSAFGGSGTNAHMIIEQAPAPDEEHTDGTSR
TSGESGAEQARPLPMVPWLLSAKTSQALAAQARRLSAHLRANPDLRSADVAHSLLTTRSV
HAERAVFIAGDRDEALAALDALADGTPAPHLVQGLADVSGKTVFVFPGQGSQWVGMAVEL
LDGSEVFAEHMAACARALEPFVDWSLEDVLRQTDGTWPLERVEVVQPVLWAVMVSLAGLW
QAHGVEPAAVLGHSQGEIAAACVAGALSLEDGARVVALRSQAIAETLAGHGGMLSIAAPA
TDIAPLIARWNERISIATVNGPHSVVVAGDPDALEALRGELETRGLRNRRIPVDYASHTP
HVEAIRERLLADLAVIQPRAASIPVLSTVTGAWLDTTVMDAEYWYRNLRQTVEFEAATRT
LLDQDHRYFVEISPHPVLSAMVRDCLDTSRPVVTAPTLRRDRTDATAALTALAEAHGHGV
PVDWASLFAGSTARAVHLPTYPFQRQHYWLDSGTGSSDMSTAGLASPDHPLLGAVTTVAG
EDGHLFTGRLSVRTHPWLADHQITGSVLLPGTAFVELAVRAGDQAGCGRVEELTLLAPLV
LPEEGSVRVQMKVGEPDATGRRTIEVYSSDQQAPGRERWVLNASGMLAGEPVEAPPSLTT
WPPEGAVPVPLDGFHDRLAARGFGYGPTFRGLSAAWSRGDEIFAEAALPSGHRQDAARFG
LHPALLDAALHAMELREPRPAGDGVRLPFAWNGFSLHASGAEAVRLRLAPTGADALSVTL
ADAIGRPVASARSLALRELSSDLLRPASVSYGDSLFRTAWIPALVGPEAESGPGRPSAGW
AVLGPDPLGAANALNLTGTSCSCYPDLAALIAAVDGGAAVPEAVLAPYAAEPAPDAGSPA
DAVRASTGRALQLLQSWLSEDRLERSRLIVLTRGAVAVGTDEGVTDLVSASVRGLVRSAQ
AEHPGRFSLVDIDDREESWAVLSAAAVSGEPQVALRCGQMKVPRLGSVDVPTTGMPEMPD
VWGVDGTVLITGGTGVLGGLVARHLVAGHGVRRLLLCSRRGPDAPGAVELVAELTALGAD
VTVAACDAADRDALAALLDTVPATHPLTGVVHTAGVIDDATVTTLTPERIDAVLRPKVDA
ALNLHQLTAHLGLTRFVLFSSAAGLFGGAGQGNYAAANAFLDALAQHRRANGLNAQSLAW
GLWAEASGMTGHLDAADLARMGRSGLTAMPTGDGLALLDTAQRVDEATLVTAALDTRALH
ARAADGTLPALFHALVPVPRRSATSPAAQAAGPDGLRQRLSGLVVGERRAALLDLVCGHV
ARVLGHADPSSIEENKGFKDTGFDSLSAVEFRNRLHGATGLRLPATLVFDYPTPAALTDH
LYDELLGSREDAVLAPITRAAYDPVDFDYPTPAALTDHLYDELLGSREDAVLAPITRAAY
DEPIAIVGMACRYPGGVESPEDLWQLVADGRDAISDFPADRGWNVESLYHPDPDHPGTSY
TRAGGFLHDAADFDPEFFGISPREALATDPQQRLLLETSWEAMERAGINPSTLKGTPTGV
FLGVMYNDYGTAMQQAAEVFEGHMASGSAGSVASGRVSYTFGLEGPAVTVDTACSSSLVA
LHLAAQALRNGECTLALAGGVAVMSTPATFVEFSRQRGLAADGRCKAFADAADGTGWGEG
VGVLLVERLSDARRNGHPVLAVVSGSAVNQDGASNGLTAPNGPSQQRVIQQALANAGLAG
ADVDAVEAHGTGTRLGDPIEAQALIATYGQARSADRPLWLGSLKSNIGHTQAAAGVAGVI
KMVQAMQHGTLPPTLHIDQPTGQVDWATGAVELLTEAVPWPDSDRPRRVAVSSFGVSGTN
AHVIIEHTPHTPHTTRTCPILPIPPGPADCAGPSAGAWLLSAKTSQALAAQARRLSAHLR
ANPDLRSADVAHSLLTTRSVHAERAVFIAGDRDEALAALDALADGTPAPHLVQGLADVSG
KTVFVFPGQGSQWVGMAVELLDGSEVFAEHMAACARALEPFVDWSLEDVLRQTDGTWPLE
RVEVVQPVLWAVMVSLAGLWQAHGVEPAAVLGHSQGEIAAACVAGALSLEDGARVVALRS
QAIAETLAGHGGMLSIAAPATDIAPLIARWNERISIATVNGPHSVVVAGDPDALEALRGE
LETRGLRNRRIPVDYASHTPHVEAIRERLLADLAVIQPRAASIPVLSTVTGAWLDTTVMD
AEYWYRNLRQTVEFEAATRTLLDQDHRYFVEISPHPVLTIGLQQTIEETTAPARTLSTLR
RNEGTLRHLFTSLAQAHAHGLTIDWTPAFTHTEPRTTPLPTYPFQHERYWLDTAEPPVGQ
GAGTDTVESGFWDAVEGEEWQTLADTLGVTADAPFDSVMSALSSWRLRQREQSLVDGWRY
RIEWKPFRAPVSAPDSVSGTWWVVVPAHAGDADRERAQAVRGTLESSGRARTILVAVDPA
ADDRGSLELKLRDAATEAGPPAGVLSLLATDERPLPGHDVVPGGLAANLALVQALGDAQI
DAPLWVGTCGAVSAGRSDRLANPGQAAVWGLGRVVALEHPERWGGLIDLPVVLDPRAVER
LVTVLAASGEEDQLAVRASGVLVRRLVRVPARQVPDGVQWKPEGTVLVTGGTGALGAEVA
RWLAHGGAEHLVLTSRRGGSAPGAAELTDELLALGTEVTLAACDMADRDAVAALLAEHAP
SSVVHTAGVLDDGVLDSLDRGRLESVLLPKVAAARHLHELTKDANVSAFVLFSSAAGVLG
SAGQGNYAAANAYLDALAEQRRADGLVAHSIAWGAWDGGGLAVGDSVVEERLRHGGVVPM
RPQLAITALQQTLDRAETAVVIADVDWPRYLTAVTPRPWLADLPEVAQALNADDAAGAPC
GTAGQGSSPLAERLSGRPAPEQRRLVLDLVRTNVAAVLGHAGAESIESGRAFRELGFDSL
TAVELRNRLAAATGLRLPTTLVFDYPSAAVLADHLYAQAIGSDEGPVADLSSGADPAAGP
DDEPIAIVSMSCRFPGGVSSPEELWQLLLAGEDTITGFPDDRDWDVDALYDPDPDHPGTT
YSRSGAFLSDAAGFDATLFGISPREALAMDPQQRLLLETAWEVFERAGIDPTSVRGSRAG
VFVGTNGQDYARHVPQEPIGVEGYLLAGNAASVISGRLSYTFGLEGPAVTVDTACSSSLV
ALHLAVQALRNGECSIALAGGVSVMSTPAAFVEFSRQRGLAADGRCKAFADAADGTGWGE
GVGVLLVERLSDARRNGHPVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIRQALVDAALT
GSDIDAVEAHGTGTRLGDPIEAQALIATYGQDRPANRPLWLGSVKSNIAHTQAAAGVAGV
IKMVQAIRHGVLPKTLHVDRPTSHVDWEAGAVELLTEAMPWPETDRPRRAGISSFGVSGT
NAHTIVEQAPAAEDEPETGPPADAPPTVVPWVLSAATEDALREQAARLATYLDERPEPSP
ADIGSSLVTTRAALDHRAVVLGEDRDALRAGLVLLANGKSGPAVVRGLARPGQKVAFLFT
GQGSQRLGMGRELHRHLPVFRQFFDEACAALDAHLPVPIAAALFAQADGADAGLIDGTEF
AQPALFALEVALCRTLEFCGVRPVYVAGHSVGEIAAAHVAGVFSLEDAARLVVARGQLMQ
ALPAGGAMVALQVSEDDLLPSLTPWLEQDRLGIAAVNGAASTVVSGDEEAVLAVAEHWQA
RGRKVRRLTVSHAFHSPRMDPMLDQFRVVVEGIRFAEPAIPVVSSVTGRLAEPGQLTTAD
YWVRHVRQTVRFHDALQTLQTENVTAFLEIGPDGQLSAMAQETLTAQVHTIPTLRKNRSE
TTGLLTALAQLHTTGTVPDWTAYLNHHPTPSTPVPTYPFQHHHYWMHGGTQATDVSSAGL
SGANHPLLGAAVPLAGGEGHLFTGRLSVRTHRWLADHQVGSTVVLPGTAFVELAVRAGDQ
VGCGHVEELTLEAPLVLPESGAVQIQLRLRRADESGRRELVVYGRLATDREDLWSEEEWT
RHASGVVVAAAPSAPEPVQLTVWPPEGATELIVKDLYERIAGTSFGYGPAFQGLRAAWRL
DDAVFAEVVLPQDQYAVASRFGLHPALLDAALHGVALGQPAADTAEPHTDRMPFSWSGVT
LYAAGATALRVRLDIASPEDVSLLVADGSGAPVAAVNSLKLRPVAADLASAGVADSLFRL
EWSKAVDDEPGRAEPGQWALIGTPPGADFTPGEDGVIIGSYPDMAALTDALDKGVAVPQR
VLLSAPSEEEQDQAHDLASAVDKATNALLAVLQQWLSDDRFDSSRLAVLTRHAVSTAGQE
DVTDLAHASWWGLVRSAQSEHPDRFVLADTDGTQISHAALLPALLSGEPQVALRDGTRYV
PRLARAVASGDGPVARVDPAGTVLVTGGTGTLGSSLARHLVVEHGVRRLLLVSRRGGESE
GAAELVAELTGLGADVTVAACDVGDRGAVAELLAGIPAGHPLTAVVHASGVTDDAVIEAL
TAEQVGRVLRSKVDGAVNLHELTRGLDLSAFVLFSSAAGVFGNPGQGNYAAANAFLDALA
VRRRAEGLAARSLAWGLWEEASAMTSRLAGADLVRMGRAGLLPLTTGQGLALFDAAHRTD
EPLVLPMRLDTTALRSTTGQPPALLRNLVRVQARRTAGAAPGPDAAATFQQQLISLSVAE
RGRVLLETVRGHAAAVLGHSGPEAVDVDKGFMEAGFDSLSAVEFRNRLTSTTGLRMPATV
TFDYPSPAALAEHLLTRLVPEVAMPAEEQHPHTRPEDGPVDRPGDEQGGAIDDMDVDSLV
ELALGE
selected fasta
>polyketide synthase [polyketide synthase]
GTGCCCAAAACAGAGACCACCGAGGAGAAGCTCTTCTCCTACCTGAAGAAGGCCACCTCC
GAACTCCAGCAGAGCCGCCGCCGGGTGGCAGAGCTGGAGGCGGCGGAGGCGGAGCCCATC
GCGATCGTGGGCACGGCCTGCCGGTACCCGGGTGGAGTACGTTCCCCGGAGGACCTGTGG
CGGTTGGTCGCGGAGGGGCAGCACGCGATCTCCAGCTTCCCGACGGACCGCGGCTGGGAT
CTCGAAGACCTCTACGACCCGGACCCGGACCGGCCCGGCAAGTCCTACGCCCGGGACGGC
GGCTTCCTCGACGGTGCCGCCCAGTTCGACGCGGCGTTCTTCGGGATCTCGCCACGTGAG
GCGCTGGCCATGGACCCGCAGCAGAGGCTGCTGCTCGAGACGACGTGGGAGGTCTTCGAG
CGCGCCGGGATCGACCCGACATCGCTCCGTGGCAGCCGGACCGGGGTGTTCGCCGGCATC
AGCCACCAGGACTACGCTGCCGGACAGCGCCCGTCGGCCGAGGTCTCCGAGGGGCACCTG
ATGACCGGCACCGCGGTCAGCGTGGTGTCCGGGCGGGTCGCCTATGCCTTCGGCCTGGAA
GGGCCGGCCATGACGGTGGACACGGCCTGCTCCTCGTCGCTGGTGGCGTTGCACCTGGCC
GCGCAGGCGTTGCGCAATGGTGAGTGCACGCTGGCGGTGGCCGGCGGCGTCACCGTCATG
GCCACGCCGGGCGCCTTCACCAGGTTCAGCCGGGAGCGGGGCCTGGCCCCGGACGGGCGC
TGCAAGGCCTTCAGCTCGGACGCCGACGGCACCGGCTTCAGCGAGGGTGTGGGTGTGCTG
CTGGTGGAGCGTTTGTCGGACGCGCGCCGCAACGGGCATCCGGTGCTGGCGGTCGTTTCG
GGCAGTGCTGTCAACCAGGACGGGGCCAGCAATGGTCTGACGGCGCCCAATGGTCCTTCG
CAGCAACGGGTGATCCAACAGGCGCTGGCCAATGCGGGGTTGGCGGGGGCGGATGTCGAT
GCCGTGGAGGCGCACGGCACGGGAACCCGGCTGGGTGACCCGATCGAGGCGCAGGCGTTG
ATCGCGACGTATGGACAGGCCCGGTCGGCGGACCGGCCGTTGTGGCTGGGTTCGCTGAAG
TCCAACATCGGCCACACCCAGGCCGCCGCGGGCGTCGCCGGCGTCATCAAGATGATCCAG
GCCATGGGTCACGGGACGCTGCCCCGTACGCTGCATGTCAACCAGCCCTCGCCCCAGGTC
GACTGGGCGGCAGGCGCGGTGGAGCTACTGACCGAAGCCATGCCCTGGCCCGAGGGTGAC
CGGCCCCGCCGGGCCGGAATCTCCTCCTTCGGAATCAGCGGTACCAACGCCCACGTCATC
ATCGAACAGGGGGCCCCGCCACGGACAGCGTCCGACCCCGGTGAAAGTCGTGCTGACGAG
CCCGGCGTACGGGGCGGCGCTCCCGTCCCTGCCACCACGGAGTCGGCCACCGAACCGCAG
CCGGTTCCCTGGCTGCTGTCCGGGCACAGCGCGACCGCGCTGCGGGCGCAGGCGGATCGC
TTGAAGTCGTACGCGGCCAACAACACCGGCATCCGTCCGGCCGACATCGGCTTCTCGCTG
GTCACCACCCGGGCCGCGCTGGAACACCGCGCTGTCGTCGTGGCAGCCGACCATGCCGGT
TTCACGGCTGGTCTCGACGCGCTGGCCGAGGGCCGGACAGCTCCCGGAGTGGTGAGCGGA
ACGGTCGTCGCCGGTGCCCGGAGCGCGTTCCTCTTCTCCGGTCAGGGCTCGCAGCGGGTC
GGCATGGGGCGCGAGCTCCAGCAGGCGTTCCCGGTTTTCGCCGAGGCTTTCGAAGCAGTC
TGCGCCCAGGTCGACCCGTACCTGGAGCACCCACTTCTCGATGTCGTACTCGCCGCGCCG
GACAGCGACTTCGGCGCGTTGCTCCATCAGACCGCCTACACGCAGCCGGCACTGTTCGCC
CTCGAAGTGGCCCTGTTCCGGCTGGTCGAATCCTGGGGTGTCAGGCCGGATTACGTTGCC
GGGCATTCGGTCGGTGAGATCGCGGCGGCCCATGTGGCGGGGGTGTTCTCGCTGGAGGAT
GCGGCTCGTCTGGTGGTGGCGCGCGGACAGTTGATGCAGGCGTTGCCGGCTGAAGGCGCG
ATGGTGGCGCTCCAGGTGTCCGAGGACGAGGTCCTGCCGTCCCTGACTCCTTGGCTGGAG
CAGGACCGGGTGGATGTCGCGGCGGTCAACGGCGCAGCATCCACAGTGGTGTCGGGCGAT
GAGGAGGCGGTCCTGGCGGTTGCCGAGCACTGGCAGGCGCGGGGCCGCAAGGTTCGTCGG
CTCACTGTCAGCCATGCCTTCCACTCACCTCGTATGGACCCGATGCTCGACCAGTTCCGT
GTGGTCGTGGAGGGTATCCGTTTCGCGGAGCCGGCCATCCCGGTCGTCTCCAGCGTCACC
GGTCGTCTTGCCGAGCCCGGGCAGTTGACCACTGCGGACTACTGGGTGCGCCACGTCCGT
CAAACGGTCCGCTTCCACGACGCCCTCCAGACCCTCCAGACCGAGAATGTGACCGCGTTT
CTGGAGATCGGTCCCGACGGGCAACTCTCGGCAATGACCCGCGACTTCCTGACCGATACC
GGGGCCCACGCCGCCGTCGCACCCCTCCTGCGGCGCGAACGTCCCGAGGCACCCAGCGCG
CTCACCGCAATCGCCGGGCTGCACACCCACGGCGTCTCGATCGACTGGCGCACGTACTTC
ACCAGCACCAGCACCAGCACCAGCACCAGCACCGGTACCGGTACCGGTACGGGGCAGGCC
ACTGCCGACACGCCCGTCCAGCTGCCCACGTACGCCTTCCAGCACCAGTCCTTCTGGCTC
GGCCCCACGGCCCCTGTCGGCGACGTCAGCACCGCCGGGCTCACCTCGCCCGACCACCCC
CTGCTCAGCGCAGCCACCACCACCGCTGTCGACGGCAGCCTCCTGCTCACCGGCAGGCTG
TCGCAGCGGTCGCCCGCGTGGATCGGCGACCACCGCATCGGCGGTGTGGTCCTGCTGCCA
GGCACCGCTCTCGTGGAACTCGTCGTACGCGCCGGGGACCAGGCCGGTTGCAGCCGCATC
GACGAACTCATCATGCTCACGCCGCTGACGCTGCCCGAGCATGGTGCCGTGCGGATCCAG
GTCGCCGTCGGCGGCCCGGCCCACGACGGCCGCCGCCCGGTGCACATCCACTCCAGCACC
TCGGACACGACCGGCGACGAACAGTGGACCCTCAACGCCAGCGGTCTGCTCACCGTCGAG
ATGACCGATCCGCCCGCCGATCTCACCCCCTGGCCGCCGCAGCACGCCACCCGCATACCG
CTCGACGGCCTCTACGAGCGGCTCGCCGAAAGCGGCTACGGATACGGCCCGGTCTTCCAG
GGCCTGCGCGCTGCCTGGACACTCGGCGACGACACCTACGCCGAGGTCGAGATCCCCGCC
GGCGACCAGACCGACACCGACCGCTACGAACTCCACCCCGCGCTCCTCGACGCCGCGCTG
CACGCGTCCTCCCTCCAGGGCGACGAGGCCGGGGCCGGGCAGCTGCTGCCGTTCGCCTGG
ACCGGGGTGTCGCTGTACGCGGCCGGCGCCTCGGCCCTGCTCGTCAAGGTGTCCCGTACC
GGTCCGGACACCATGGCGCTGCTCGTGGCCGACACCGAGGGCCACCCGGTCGCCACCGTC
GACTCACTGACTGTCCGGCCGATGGCCATCGACCAGACCGCCCGGAGCACCAGCCACCCT
GACGCGCTGTTCACCGTGGGGCTGGAGTGGGCCCAAGCCCGGGAGGGCAACCGGACCATC
CCCCTGTCCGACTGCGCCATGCTGGCTCCGGACGAACCGGACCTCACCTCCGCCCCGGCC
TGGCCCGGGTCCTCCGCGCAGCGGTACGCCGGCCTCGCGGCGCTCGCTGAGATCTGCGGA
ACGGACGGGCCGGTACCTGCCGTGGTACTGGCGCCCTTCCTCCCCGGCGATGCCGCGCCC
GCCGACACCGCCGCCGCGACGCACGCGACGACGCGCCGCGCCGCCGCTCTCATCAAGGGC
TGGCTGGGCGACGACCGTTTCACCGACTCGCGTCTGGTCTTCGTCACCCGTGGCGCGGTG
GCCACCAGCGGCCGGGACGAACTGCACGACCTGGAACACTCCACGGTCTGGGGTCTGGTC
CGGTCGGCCCAGACCGAGAACCCCGGCAGGTTCGCGCTGCTCGATCTCGACGACCCGGAC
ACCGTCACCGAACTGCCGGAAGCCATCCTGGCCGATCAGGCACAGCTGGTCCTGCGGGAC
GGGCGGCTGGGAAACCTCCGGCTGGCCAAGGGCGCTGCGATACAGGATCCCGACCCGGGT
TGGGGTGTTGACGGTACCGTGTTGATCACTGGCGGGACCGGTGTGCTGGGTGGGCTCGTC
GCCCGTCATCTGGTCGCCGGGCATGGGGTCCGTCGTCTGTTGCTCTGCAGCAGGCGGGGC
CCTGATGCGCCGGGTGCGGTGGAGCTGGTCGCCGAGCTCACCGCTCTGGGTGCGGATGTC
ACCGTTGCCGCCTGCGACGCGGCTGACCGGGATGCGCTGGCCGCGCTCTTGGACACCGTT
CCCGCCACGCACCCTCTGACTGGTGTCGTGCATACCGCTGGTGTCATCGATGACGCCACT
GTCACCACCCTCACTCCCGAGCGCATCGACGCGGTCCTACGCCCCAAGGTCGACGCCGCG
CTCAACCTCCATCAGCTGACGGCGCATCTCGGCTTGACCCGCTTTGTGCTCTTCTCCTCC
GCCGCCGGGCTCTTCGGCGGCGCGGGCCAGGGTAACTACGCGGCCGCCAACGCCTTCCTC
GACGCACTGGCGCAGCTGCGGAAGCGGCAGGGACTGCCGGGCGTGTCGCTGGCCTGGGGT
GCCTGGGTCCAGGACGGCGGAATGACCGCAACGCTGGACGCGGGCGACGTCGAGCGGATG
GCGCGCGGCGGTGTGCTGCCGCTCAGCCACGAGCAGGGCCTGAACCTGTTCGACCTGGCA
GTGGCAGGGTCCGAGCCGCTGGTGGCACCGATGCGGCTGGACACCACCGCGCTGCGCGAG
TCCGGTGCCACCGTGCCGGAGATGCTGCGCGGGTTGGTGCGTGAGCGGTCACGCCGCCGG
GTCGGACCCTCGCACACGACGTCCGCCGCCATGGCGCTGGAACAACGGTTGTCGGGGTTG
GTCGAGGGGGAGCGTCGAGCGGCGCTGCTGGATTTGGTGTGTGGTCATGTCGCGAGGGTG
CTGGGGCACGCGGACCCGAGCAGCATTGAGGAGACCCGGCCCTTCAAGGACACCGGCTTC
GACTCATTGACCGCTGTGGAGCTGCGCAATGTGCTGCACGGTGCGACCGGGTTGCGGCTG
CCGGCCACGCTGGTCTTCGACTACCCGACGCCTGCAGCTCTCACCGATCACCTCTACGAC
GAGCTTCTGGGTTCCCGCGAGGACGCCGTGCTCGCCCCGATCACCAGGGCCGCGTACGAC
GAGCCGATCGCCATCGTAGCGATGTCCTGCCGGTACCCGGGCGGTGTCTGCACTCCGGAG
GACCTGTGGCGGCTGGTGGCCGAGGGCCGGGACACGATCACGGACTTCCCGGACGACCGC
GGCTGGGATATCGACGCCCTGTATGACCCCGACCCGGGCCACCCCGGCACCTCCTACACC
CGGCGGGGCGGCTTCCTGTCCGACGCGGCGGGTTTCGATCCGGCGTTCTTCCGGATCTCC
CCCCGCGAGGCGCTGGCCATGGACCCGCAGCAGCGGCTGCTGCTCGAAATGACGTGGGAG
ATGTTCGAACGGGCGCTCATCGACCCAACAACGCTGAAGGGCAGCCAGGCCGGGGTGTTC
ATCGGCACCGCCGGCCCCGGCTACGGCGGCCGCATCCACCACGAGTCGCAGGGCGTCGAG
GGCCAGCAGCTGTTCGGCGGCTCGGCCGCCGTGACCTCAGGCCGGATCTCGTACACGTTC
GGCCTGGAAGGGCCGGCGATGACGGTGGACACCATGTGCTCGTCCTCGCTGGTGGCCCTG
CACCTGGCCGTCCAGTCCCTGCGCAACGGCGAGTCCTCGATGGCGCTCGCCGGCGGGGTC
ACGGTGATGTCCCGGCCGGCCGCGTTCACCGAGTTCAGCCGGCAGCGGGGGCTGTCCCCC
GACGGGCGGTGCAAGTCGTTCGCCGACGCGGCCGACGGCACCGGCTGGGGCGAGGGCGCC
GGCGTGCTCCTCCTCGAGCGGCTCTCCGACGCCCGTCGCAACGGCCACCCGGTGCTGGCC
GTCATCCGCGGCAGCGCCGTCAACCAGGACGGCGCCAGCAACGGCCTCACGGCACCCAAC
GGCCCCTCGCAGCAACGCGTCATCCGCCAGGCCCTGGCGAACGCGTCCCTGTCGCCGGCC
GACGTCGACGCCGTCGAGGCCCACGGCACCGGGACCCCCCTGGGCGACCCGATCGAGGCG
CAGGCCCTGATCGCCACCTACGGACAGGACCGCCCGGCGGACCGGCCGCTGCGGCTGGGC
TCGGTGAAGTCCAACATCGCCCACGCGCAGGCCGCAGCCGCAGTCGGCGGCGTCATCAAG
ATGGTCCAGGCGATCCGGCACGGCCTCCTCCCGAAGACCCTGCACGTGGAGCAGCCCTCC
CGCCACGTCGACTGGTCCGCCGGCTCGGTGGAGCTGCTCACCGAGGCGATGCCGTGGCCG
GAGACCGACCAACCCCGGCGGGCCGGTGTCTCGGCGTTCGGCGGCAGCGGCACCAACGCC
CACATGATCATCGAGCAGGCGCCCGCGCCGGACGAGGAGCACACCGACGGCACGAGCAGG
ACCAGCGGCGAGAGCGGCGCCGAACAGGCCAGGCCGCTGCCGATGGTGCCCTGGCTGCTG
TCGGCGAAGACCTCGCAGGCCCTGGCCGCGCAGGCCCGGCGCCTGTCAGCTCACTTGCGA
GCCAACCCCGATCTGCGTTCGGCTGATGTGGCGCATTCCCTGCTCACCACGCGGTCTGTC
CACGCCGAGCGCGCCGTCTTCATCGCCGGTGACCGGGATGAGGCTCTTGCCGCCCTGGAC
GCACTGGCCGACGGCACCCCTGCCCCTCACCTCGTTCAGGGCCTTGCCGATGTGAGTGGC
AAGACGGTGTTCGTCTTCCCCGGTCAGGGTTCGCAGTGGGTGGGTATGGCCGTTGAGCTG
CTGGACGGCTCGGAGGTTTTCGCCGAGCATATGGCCGCCTGCGCCAGGGCCCTGGAACCG
TTTGTGGACTGGTCCCTGGAGGACGTCCTACGCCAGACGGACGGTACGTGGCCACTGGAA
CGCGTCGAAGTGGTCCAGCCCGTGCTGTGGGCGGTCATGGTCTCGCTCGCGGGACTGTGG
CAGGCACATGGCGTTGAGCCTGCTGCGGTGCTGGGCCACTCCCAAGGTGAGATCGCTGCG
GCTTGCGTGGCGGGAGCCCTGAGTCTGGAAGACGGAGCCCGCGTTGTCGCGCTTCGCAGC
CAAGCCATCGCCGAAACCCTCGCAGGACACGGCGGAATGCTCTCAATCGCCGCCCCCGCC
ACCGACATCGCACCCCTGATCGCCCGCTGGAACGAGCGGATCTCCATCGCCACGGTCAAC
GGACCGCATTCGGTGGTGGTCGCAGGAGACCCTGACGCGCTCGAGGCACTCCGCGGCGAA
CTGGAGACCCGTGGTCTCCGCAATCGTCGCATCCCGGTCGACTACGCCTCACACACCCCT
CACGTCGAGGCGATCCGTGAACGGCTCCTGGCCGACCTGGCAGTGATCCAGCCACGTGCC
GCGAGCATTCCCGTGCTGTCCACCGTCACCGGCGCATGGCTCGACACCACCGTGATGGAC
GCCGAGTACTGGTACCGCAACCTACGTCAGACCGTGGAGTTCGAAGCAGCCACCCGCACT
CTCCTCGACCAGGACCACCGCTACTTCGTCGAGATCAGCCCGCACCCCGTACTCTCGGCG
ATGGTCCGCGACTGCCTGGACACCAGCCGCCCGGTGGTCACGGCACCCACCCTCCGACGT
GACCGTACCGATGCCACTGCCGCGTTGACGGCACTGGCCGAAGCGCACGGGCACGGGGTG
CCGGTCGACTGGGCGTCGCTCTTCGCCGGCTCGACCGCCCGGGCGGTCCACCTGCCGACG
TACCCCTTCCAGCGGCAACACTACTGGCTGGATTCCGGTACGGGCAGCAGTGACATGAGC
ACGGCCGGACTGGCGTCCCCCGATCATCCGCTGTTGGGAGCCGTGACGACGGTGGCCGGC
GAGGACGGCCACCTCTTCACCGGCCGGCTGTCGGTACGGACGCACCCATGGCTGGCCGAC
CACCAGATCACCGGTTCGGTCCTGTTGCCGGGCACGGCCTTCGTCGAACTGGCCGTCCGG
GCCGGGGACCAGGCCGGCTGCGGGCGGGTCGAGGAGCTGACGCTGCTGGCTCCGCTCGTA
CTGCCCGAAGAGGGCAGCGTCAGGGTCCAGATGAAGGTGGGGGAGCCCGACGCCACGGGC
CGCCGCACCATCGAGGTGTACTCCTCGGACCAGCAGGCCCCCGGCCGGGAACGCTGGGTC
CTCAACGCGAGCGGGATGCTTGCCGGCGAACCGGTGGAGGCCCCGCCGAGTCTCACCACC
TGGCCCCCGGAAGGCGCTGTCCCCGTTCCGCTGGACGGCTTCCACGACCGGCTGGCGGCA
CGCGGCTTCGGCTACGGTCCGACATTCCGCGGGCTGAGCGCCGCGTGGTCACGCGGTGAC
GAGATCTTCGCCGAAGCGGCGCTCCCCTCGGGCCATCGGCAGGATGCCGCCCGGTTCGGA
CTCCACCCGGCGCTACTCGACGCTGCCCTGCACGCCATGGAACTCCGGGAACCCCGCCCG
GCCGGCGACGGAGTCCGGCTTCCGTTCGCCTGGAACGGCTTCTCCCTGCACGCGTCGGGT
GCCGAAGCGGTACGGCTGCGCCTCGCGCCGACGGGCGCCGACGCTCTGTCGGTGACCCTC
GCCGATGCCATCGGTCGCCCGGTTGCCTCAGCCCGCTCGCTGGCCCTGCGGGAGCTCTCG
TCCGACCTGCTGCGCCCGGCGTCCGTCTCGTACGGGGACTCGCTGTTCCGCACCGCTTGG
ATACCCGCCCTCGTCGGCCCGGAGGCGGAGTCCGGGCCGGGGCGACCGTCCGCCGGCTGG
GCGGTGCTGGGCCCCGATCCGCTCGGCGCGGCCAACGCCCTGAACCTCACGGGAACCTCC
TGCTCCTGCTATCCGGACCTGGCGGCGCTGATCGCGGCCGTCGACGGCGGAGCCGCGGTG
CCCGAGGCCGTACTCGCGCCGTACGCGGCGGAGCCAGCCCCGGACGCGGGATCTCCCGCG
GACGCCGTACGGGCCTCGACCGGCCGGGCGCTGCAACTGCTGCAATCCTGGCTGTCCGAG
GACCGGTTGGAGCGAAGCCGGCTGATCGTGCTCACCCGGGGGGCGGTGGCCGTCGGTACG
GACGAAGGCGTCACCGACCTGGTGAGTGCGTCGGTCCGGGGTCTGGTCCGTTCGGCGCAG
GCCGAGCACCCTGGCAGGTTCTCCCTGGTCGACATCGACGACCGGGAGGAGTCCTGGGCC
GTCCTGAGCGCGGCGGCGGTATCCGGTGAGCCGCAGGTCGCCCTGCGCTGCGGCCAGATG
AAGGTGCCCCGCCTCGGCTCCGTCGACGTTCCCACGACCGGTATGCCTGAGATGCCCGAC
GTTTGGGGTGTTGACGGTACCGTGTTGATCACTGGCGGGACCGGTGTGCTGGGTGGGCTC
GTCGCCCGTCATCTGGTCGCCGGGCATGGGGTCCGTCGGTTGTTGCTCTGCAGCAGGCGG
GGCCCTGATGCGCCGGGTGCGGTGGAGCTGGTGGCCGAGCTCACCGCTCTGGGTGCGGAT
GTCACCGTTGCCGCCTGTGATGCGGCCGACCGGGATGCGCTGGCCGCGCTCTTGGACACC
GTTCCCGCCACGCACCCTCTGACTGGTGTCGTGCATACCGCTGGTGTCATCGATGACGCC
ACTGTCACCACCCTCACTCCCGAGCGCATCGACGCGGTCCTACGCCCCAAGGTCGACGCC
GCGCTCAACCTCCATCAGCTGACGGCGCATCTCGGCTTGACCCGCTTTGTGCTCTTCTCT
TCGGCCGCCGGGCTCTTCGGCGGCGCGGGGCAGGGCAACTACGCGGCGGCCAACGCCTTC
CTCGACGCACTGGCCCAACACCGCCGGGCCAACGGCCTCAATGCCCAGTCCCTGGCGTGG
GGACTGTGGGCGGAAGCCAGCGGGATGACCGGGCACCTGGACGCGGCCGACCTCGCCCGG
ATGGGCCGTTCCGGCCTCACCGCGATGCCCACCGGGGACGGGCTGGCGCTGCTCGACACC
GCCCAGCGGGTGGACGAAGCCACCCTGGTCACGGCCGCGCTGGACACCCGGGCCCTGCAT
GCCCGGGCCGCAGACGGCACGCTGCCGGCGCTGTTCCACGCACTCGTGCCCGTACCGCGC
CGATCCGCGACCTCCCCGGCGGCCCAGGCCGCGGGGCCGGATGGACTCCGCCAGCGGTTG
TCGGGGCTGGTCGTGGGGGAGCGCCGAGCGGCGCTGCTGGATTTGGTGTGTGGTCATGTC
GCGAGGGTGCTGGGGCACGCGGACCCGAGCAGCATTGAGGAGAACAAGGGCTTCAAGGAC
ACCGGCTTCGACTCCTTGAGCGCGGTGGAGTTCCGCAACCGGCTGCACGGTGCGACCGGG
TTGCGGCTGCCGGCCACGCTGGTCTTCGACTACCCGACGCCTGCAGCTCTCACCGATCAC
CTCTACGACGAGCTTCTGGGTTCCCGCGAGGACGCCGTGCTCGCCCCGATCACCAGGGCC
GCGTACGACCCGGTGGACTTCGACTACCCGACGCCTGCAGCTCTCACCGATCACCTCTAC
GACGAGCTTCTGGGTTCCCGCGAGGACGCCGTGCTCGCCCCGATCACCAGGGCCGCGTAC
GACGAGCCGATCGCGATCGTGGGGATGGCCTGCCGCTATCCGGGCGGGGTGGAGTCCCCG
GAGGACCTGTGGCAGCTGGTCGCCGACGGCCGTGACGCCATCTCCGACTTCCCCGCCGAC
CGGGGCTGGAACGTCGAGAGCCTCTACCACCCCGACCCCGACCACCCCGGCACCAGCTAC
ACCCGTGCCGGAGGCTTCCTGCACGACGCGGCGGACTTCGACCCGGAGTTCTTCGGGATC
TCACCGCGTGAGGCACTGGCCACCGACCCCCAGCAGCGACTGCTGCTGGAAACCAGCTGG
GAAGCCATGGAACGGGCGGGAATCAACCCCTCCACCCTGAAGGGCACCCCCACCGGCGTC
TTCCTCGGCGTCATGTACAACGACTACGGCACTGCCATGCAGCAGGCGGCAGAGGTCTTC
GAGGGCCATATGGCCAGCGGTAGCGCGGGGAGTGTGGCGTCGGGCCGGGTCTCGTACACG
TTCGGTCTGGAGGGACCGGCCGTCACGGTGGATACCGCGTGTTCGTCGTCGCTGGTGGCG
TTGCATCTGGCCGCGCAGGCGTTGCGCAACGGTGAGTGCACTCTGGCTCTGGCGGGCGGT
GTTGCGGTGATGTCCACTCCTGCCACGTTTGTCGAGTTCAGCCGGCAGCGGGGGCTGGCA
GCTGATGGGCGGTGCAAAGCCTTCGCGGACGCTGCCGACGGCACCGGCTGGGGCGAAGGC
GTCGGTGTGCTGCTGGTGGAGCGTTTGTCGGACGCGCGCCGCAACGGGCATCCGGTGCTG
GCGGTCGTTTCGGGCAGTGCTGTCAACCAGGACGGGGCCAGCAATGGTCTGACGGCGCCC
AATGGTCCTTCGCAGCAACGGGTGATCCAACAGGCGCTGGCCAATGCGGGGTTGGCGGGG
GCGGATGTCGATGCCGTGGAGGCGCACGGCACGGGAACCCGGCTGGGCGACCCGATCGAG
GCGCAAGCGTTGATCGCCACCTACGGACAGGCCCGGTCGGCGGACCGGCCGTTGTGGCTG
GGTTCGCTGAAGTCCAACATCGGTCACACCCAGGCCGCCGCGGGCGTCGCCGGCGTCATC
AAAATGGTGCAGGCGATGCAGCACGGGACTCTGCCGCCCACCCTGCACATCGACCAGCCC
ACGGGCCAGGTCGACTGGGCTACGGGTGCAGTGGAGCTGCTGACCGAGGCCGTGCCCTGG
CCGGACAGTGACCGGCCCCGCCGGGTGGCTGTCTCCTCGTTCGGTGTCAGCGGTACCAAC
GCCCACGTCATCATCGAACACACCCCACACACCCCACACACCACCCGCACCTGCCCAATC
CTCCCAATCCCCCCAGGCCCCGCAGACTGTGCAGGCCCATCGGCCGGTGCGTGGCTGCTG
TCGGCGAAGACCTCGCAGGCCCTGGCCGCGCAGGCCCGGCGCCTGTCAGCTCACTTGCGA
GCCAACCCCGATCTGCGTTCGGCTGATGTGGCGCATTCCCTGCTCACCACGCGGTCTGTC
CACGCCGAGCGCGCCGTCTTCATCGCCGGTGACCGGGATGAGGCTCTTGCCGCCCTGGAC
GCACTGGCCGACGGCACCCCTGCCCCTCACCTCGTTCAGGGCCTTGCCGATGTGAGTGGC
AAGACGGTGTTCGTCTTCCCCGGTCAGGGTTCGCAGTGGGTGGGTATGGCCGTTGAGCTG
CTGGACGGCTCGGAGGTTTTCGCCGAGCATATGGCCGCCTGCGCCAGGGCCCTGGAACCG
TTTGTGGACTGGTCCCTGGAGGACGTCCTACGCCAGACGGACGGTACGTGGCCACTGGAA
CGCGTCGAAGTGGTCCAGCCCGTGCTGTGGGCGGTCATGGTCTCGCTCGCGGGACTGTGG
CAGGCACATGGCGTTGAGCCTGCTGCGGTGCTGGGCCACTCCCAAGGTGAGATCGCTGCG
GCTTGCGTGGCGGGAGCCCTGAGTCTGGAAGACGGAGCCCGCGTTGTCGCGCTTCGCAGC
CAAGCCATCGCCGAAACCCTCGCAGGACACGGCGGAATGCTCTCAATCGCCGCCCCCGCC
ACCGACATCGCACCCCTGATCGCCCGCTGGAACGAGCGGATCTCCATCGCCACGGTCAAC
GGACCGCATTCGGTGGTGGTCGCAGGAGACCCTGACGCGCTCGAGGCACTCCGCGGCGAA
CTGGAGACCCGTGGTCTCCGCAATCGTCGCATCCCGGTCGACTACGCCTCACACACCCCT
CACGTCGAGGCGATCCGTGAACGGCTCCTGGCCGACCTGGCAGTGATCCAGCCACGTGCC
GCGAGCATTCCCGTGCTGTCCACCGTCACCGGCGCATGGCTCGACACCACCGTGATGGAC
GCCGAGTACTGGTACCGCAACCTACGTCAGACCGTGGAGTTCGAAGCAGCCACCCGCACT
CTCCTCGACCAGGACCACCGCTACTTCGTCGAGATCAGCCCGCACCCCGTACTCACCATC
GGTCTACAGCAGACCATCGAGGAAACCACCGCTCCGGCCCGGACCCTCTCCACCCTCCGA
CGCAACGAAGGCACCCTCCGGCACCTGTTCACTTCCCTCGCCCAGGCCCACGCCCACGGC
CTGACCATCGACTGGACCCCCGCCTTCACCCACACCGAGCCCCGCACCACCCCCCTGCCC
ACCTACCCCTTCCAACACGAACGCTACTGGCTGGACACGGCGGAGCCGCCTGTTGGGCAG
GGAGCCGGCACCGACACCGTCGAGAGCGGTTTTTGGGACGCCGTCGAGGGCGAGGAGTGG
CAGACGTTGGCCGACACGCTCGGCGTTACCGCCGACGCGCCGTTCGACTCCGTGATGTCC
GCCCTGTCGTCCTGGCGGCTCCGACAGCGTGAGCAGTCCTTGGTGGACGGCTGGCGTTAC
CGGATCGAGTGGAAGCCGTTCCGCGCCCCCGTGTCGGCACCGGATTCCGTGTCGGGCACC
TGGTGGGTGGTCGTTCCCGCCCATGCCGGCGACGCGGACCGGGAGAGGGCGCAAGCCGTG
CGGGGCACGCTGGAGTCCTCCGGCCGTGCGCGGACGATCCTGGTCGCGGTGGACCCGGCC
GCCGACGACCGGGGGTCGCTCGAACTGAAACTCAGGGACGCCGCGACCGAGGCGGGTCCG
CCGGCCGGGGTGCTGTCCCTGCTGGCCACCGACGAACGTCCCCTCCCCGGGCATGATGTG
GTGCCCGGGGGGCTGGCAGCCAACCTGGCTCTCGTCCAGGCACTGGGCGACGCGCAGATC
GATGCCCCGCTCTGGGTGGGCACCTGCGGGGCGGTCTCCGCCGGCCGGTCCGACCGGCTG
GCGAACCCCGGGCAGGCCGCGGTCTGGGGGCTCGGACGGGTGGTCGCCCTGGAGCACCCG
GAACGCTGGGGCGGTCTGATCGATCTGCCCGTGGTCCTCGACCCGCGCGCTGTGGAACGG
CTGGTGACAGTACTTGCCGCGTCGGGCGAGGAGGACCAGCTCGCCGTACGGGCGTCGGGG
GTCCTCGTGCGCAGGCTCGTGCGGGTACCCGCACGCCAAGTGCCGGACGGCGTGCAGTGG
AAGCCCGAGGGGACGGTCCTGGTGACCGGTGGGACCGGAGCGCTGGGCGCGGAGGTCGCG
CGGTGGCTGGCTCATGGCGGCGCCGAACACCTGGTGCTGACCAGCCGTCGCGGCGGCTCG
GCGCCCGGTGCGGCCGAGCTGACGGACGAGCTGCTTGCCCTCGGGACGGAAGTGACACTG
GCCGCCTGTGACATGGCAGACCGGGACGCGGTCGCCGCGCTGCTCGCCGAGCACGCGCCG
AGCTCGGTGGTGCACACCGCCGGCGTCCTCGACGACGGTGTACTGGACAGCCTGGACCGC
GGGCGGCTGGAGTCGGTTCTGCTGCCGAAGGTGGCCGCCGCTCGGCACCTGCACGAGTTG
ACGAAGGACGCGAACGTGTCGGCATTCGTGTTGTTCTCGTCCGCCGCAGGCGTGCTCGGC
AGCGCAGGCCAGGGCAACTACGCAGCCGCCAACGCCTACCTGGACGCCCTGGCCGAACAG
CGCAGGGCCGATGGACTGGTCGCCCATTCGATCGCCTGGGGCGCGTGGGACGGCGGTGGG
CTGGCCGTGGGCGACAGCGTGGTCGAGGAACGGCTGCGCCACGGAGGAGTGGTCCCCATG
CGCCCGCAGCTGGCGATCACGGCGCTCCAGCAGACGTTGGACCGGGCGGAGACCGCGGTG
GTCATCGCTGACGTTGACTGGCCGCGCTACCTCACCGCGGTCACACCGCGCCCATGGCTG
GCGGACCTGCCGGAGGTCGCCCAGGCCCTTAACGCCGACGACGCGGCTGGTGCCCCTTGC
GGCACAGCCGGGCAGGGCTCGTCCCCGCTGGCCGAGCGTCTCTCCGGGCGCCCGGCACCC
GAGCAGCGGCGACTGGTGCTCGACCTGGTCCGTACGAACGTGGCGGCGGTGCTCGGCCAC
GCCGGTGCGGAGTCGATCGAGTCCGGCCGGGCCTTCCGCGAGCTGGGCTTCGACTCTCTG
ACCGCCGTCGAGCTGCGCAACAGGCTGGCTGCGGCCACCGGGCTGCGGCTGCCCACCACC
CTGGTGTTCGACTACCCGAGCGCTGCCGTGCTCGCCGATCACCTGTACGCGCAGGCGATC
GGTTCGGACGAGGGGCCCGTGGCGGATCTGTCCTCCGGCGCCGATCCGGCGGCCGGACCG
GACGACGAGCCCATCGCCATCGTGTCGATGAGCTGCCGTTTCCCCGGCGGTGTCTCCTCC
CCGGAGGAGCTGTGGCAGCTGCTGCTGGCCGGTGAGGACACGATTACCGGGTTCCCGGAC
GACCGGGACTGGGATGTCGACGCCCTGTACGACCCGGACCCGGACCACCCGGGGACCACG
TATTCCCGCAGCGGCGCGTTCCTGTCCGACGCGGCCGGTTTCGACGCGACGCTGTTCGGG
ATCTCGCCGCGTGAGGCGCTGGCCATGGACCCGCAGCAGCGGCTGCTGCTGGAGACGGCA
TGGGAGGTGTTCGAGCGGGCGGGCATCGATCCCACCTCGGTACGTGGCAGCCGGGCCGGC
GTTTTCGTCGGGACCAACGGCCAGGACTACGCCCGCCATGTGCCCCAGGAACCGATCGGC
GTGGAGGGGTATCTGCTGGCGGGCAATGCGGCCAGCGTCATCTCCGGCCGTCTGTCGTAC
ACGTTTGGTCTGGAGGGGCCGGCCGTCACGGTGGACACCGCGTGTTCGTCCTCGCTGGTC
GCCCTGCACCTCGCCGTCCAGGCCTTGCGCAACGGCGAATGCTCCATAGCCCTGGCGGGA
GGCGTGTCGGTGATGTCCACCCCGGCGGCGTTCGTGGAATTCAGCCGGCAGCGGGGGCTG
GCGGCTGACGGGCGGTGCAAGGCGTTCGCGGACGCGGCGGACGGCACCGGCTGGGGCGAG
GGGGTTGGCGTGCTCCTCGTGGAGCGTCTGTCCGACGCGCGCCGCAACGGTCACCCGGTG
CTGGCCGTCGTACGCGGCAGCGCCGTTAACCAGGACGGCGCCAGCAACGGCCTCACGGCG
CCCAACGGACCCTCGCAGCAACGCGTCATCCGCCAGGCACTCGTTGACGCCGCGCTGACC
GGTAGCGACATCGACGCCGTCGAAGCCCACGGCACCGGGACCCGGCTGGGTGACCCGATC
GAGGCGCAGGCCCTGATCGCCACCTACGGTCAGGACCGCCCGGCGAACCGGCCCCTGTGG
CTGGGCTCGGTCAAATCCAACATCGCACACACGCAGGCCGCCGCGGGCGTCGCCGGCGTC
ATCAAGATGGTCCAGGCGATCCGCCATGGCGTACTTCCCAAGACCCTGCACGTGGACCGG
CCGACCAGCCACGTCGACTGGGAGGCAGGCGCGGTGGAGTTGCTGACCGAGGCCATGCCC
TGGCCGGAGACCGACCGGCCGCGTCGGGCCGGCATCTCTTCCTTCGGCGTCAGCGGCACC
AACGCACACACCATCGTGGAGCAGGCACCTGCGGCGGAAGACGAGCCGGAAACGGGGCCA
CCCGCCGATGCTCCGCCCACGGTGGTGCCCTGGGTGCTCTCCGCTGCCACCGAGGACGCG
CTGCGAGAGCAGGCCGCACGCCTCGCCACGTACCTCGACGAGCGCCCCGAGCCAAGCCCG
GCCGACATCGGGTCCTCCCTGGTCACCACGCGTGCAGCCCTTGACCACCGGGCGGTGGTG
CTCGGTGAGGACCGCGACGCTCTGCGGGCCGGGCTGGTTCTGCTGGCGAACGGGAAGTCC
GGTCCCGCTGTCGTCCGTGGCCTCGCCAGGCCCGGACAGAAGGTGGCGTTCCTGTTCACC
GGGCAGGGCAGCCAGCGACTGGGCATGGGCAGGGAGCTCCATCGCCACCTGCCGGTGTTC
CGGCAGTTCTTCGACGAGGCGTGCGCCGCGCTCGACGCACACCTGCCGGTACCGATAGCG
GCCGCGCTGTTCGCGCAGGCGGATGGGGCGGATGCGGGGCTGATCGATGGGACGGAATTC
GCGCAGCCGGCGTTGTTCGCGCTGGAGGTGGCGTTGTGCCGGACGTTGGAGTTCTGCGGT
GTCAGGCCGGTTTACGTTGCCGGGCATTCGGTCGGTGAGATCGCGGCGGCCCATGTGGCG
GGGGTGTTCTCGCTGGAGGATGCGGCTCGTCTGGTGGTGGCGCGCGGACAGTTGATGCAG
GCGTTGCCGGCCGGTGGTGCGATGGTCGCGCTCCAGGTGTCCGAAGACGACCTCCTGCCA
TCCTTGACTCCTTGGCTGGAGCAGGACCGGCTGGGTATCGCGGCGGTCAACGGCGCAGCA
TCCACAGTGGTGTCGGGCGATGAGGAGGCGGTCCTGGCGGTTGCCGAGCACTGGCAGGCG
CGGGGCCGCAAGGTTCGTCGGCTCACTGTCAGCCATGCCTTCCACTCACCTCGTATGGAC
CCGATGCTCGACCAGTTCCGTGTGGTCGTGGAGGGTATCCGTTTCGCGGAGCCGGCCATC
CCGGTCGTCTCCAGCGTCACCGGTCGTCTTGCCGAGCCCGGGCAGTTGACCACTGCGGAC
TACTGGGTGCGCCACGTCCGTCAAACGGTCCGCTTCCACGACGCCCTCCAGACCCTCCAG
ACCGAGAATGTGACCGCGTTTCTGGAGATCGGTCCCGACGGGCAACTCTCGGCAATGGCC
CAGGAGACGCTCACCGCCCAGGTCCATACCATCCCCACCCTCCGAAAGAACCGGTCTGAG
ACCACCGGCTTGCTCACCGCACTGGCGCAACTCCACACCACCGGCACCGTCCCCGACTGG
ACCGCTTACCTCAACCACCACCCCACACCCTCCACACCCGTGCCCACCTACCCCTTCCAA
CACCACCACTACTGGATGCACGGCGGTACCCAGGCCACCGATGTCAGCTCCGCCGGCCTG
TCAGGAGCCAACCACCCGCTGCTGGGGGCCGCGGTCCCGCTGGCCGGTGGGGAGGGCCAC
CTGTTCACCGGCCGGCTGTCGGTGCGGACCCACCGCTGGCTGGCCGACCACCAGGTCGGC
AGCACCGTCGTGTTGCCGGGCACTGCCTTCGTCGAACTGGCGGTACGGGCCGGTGACCAG
GTCGGCTGCGGCCACGTGGAGGAGCTGACGCTGGAAGCGCCGCTCGTGCTGCCCGAGAGC
GGCGCCGTACAGATACAGCTCCGGCTGCGCCGGGCGGACGAATCCGGACGGCGTGAACTC
GTCGTGTACGGGCGGCTCGCGACGGACCGTGAGGACCTGTGGTCCGAGGAGGAATGGACC
CGGCACGCCAGCGGTGTCGTCGTCGCAGCAGCGCCCTCGGCCCCCGAGCCCGTCCAACTG
ACCGTATGGCCCCCGGAAGGCGCCACCGAGCTCATCGTGAAGGACCTCTACGAACGGATC
GCCGGCACCAGCTTCGGCTACGGTCCCGCCTTCCAAGGGCTGCGCGCCGCCTGGCGGCTG
GACGACGCGGTGTTCGCGGAGGTCGTGCTGCCACAGGATCAGTACGCCGTCGCGAGCCGG
TTCGGACTCCACCCGGCGCTGCTCGACGCCGCCCTCCACGGGGTCGCGCTGGGGCAGCCG
GCGGCTGACACCGCCGAGCCGCACACCGACCGGATGCCCTTCTCCTGGAGCGGCGTTACC
CTCTACGCCGCCGGTGCCACCGCACTGCGGGTGCGGTTGGACATCGCTTCGCCCGAGGAC
GTGTCGCTGCTCGTCGCCGATGGCTCGGGGGCTCCGGTGGCCGCGGTGAACTCGCTGAAG
CTGCGCCCGGTCGCGGCCGACCTGGCCAGTGCCGGTGTCGCCGACTCGCTGTTCCGGCTG
GAGTGGTCGAAGGCGGTCGACGACGAGCCCGGCCGGGCCGAACCGGGGCAATGGGCCCTG
ATCGGAACGCCGCCCGGTGCCGACTTCACGCCGGGCGAGGACGGCGTCATCATCGGAAGC
TACCCGGACATGGCCGCGTTGACCGACGCGCTCGACAAGGGAGTCGCCGTCCCGCAGCGG
GTGTTGTTGTCCGCCCCGTCGGAGGAGGAGCAGGACCAGGCGCACGATCTCGCGAGCGCG
GTGGACAAGGCCACGAACGCGCTGCTCGCAGTGCTCCAGCAGTGGCTGTCCGACGACCGG
TTCGACTCCTCCAGGCTGGCTGTGCTGACCCGTCACGCGGTGTCCACGGCTGGGCAGGAG
GACGTGACGGACCTTGCCCACGCCTCGTGGTGGGGACTCGTTCGCTCGGCGCAGTCCGAA
CATCCCGACCGGTTCGTGCTGGCCGACACCGACGGCACCCAGATCAGTCACGCTGCCCTT
CTGCCCGCTTTGCTGTCCGGTGAGCCGCAGGTCGCGCTGCGTGACGGAACCCGGTATGTG
CCGCGGCTGGCCAGGGCCGTTGCGTCCGGGGACGGGCCGGTGGCGCGGGTGGACCCGGCG
GGGACGGTGTTGGTGACCGGTGGTACGGGGACTCTGGGGTCTTCGCTGGCCAGGCATTTG
GTGGTTGAGCACGGGGTGCGGCGGTTGTTGCTGGTGAGCCGTCGGGGCGGGGAGTCGGAG
GGCGCGGCGGAGTTGGTGGCTGAGCTGACCGGGCTCGGGGCGGATGTCACGGTGGCGGCG
TGTGATGTGGGGGACCGGGGGGCCGTGGCGGAGTTGCTGGCGGGGATTCCGGCCGGTCAT
CCGTTGACGGCGGTGGTGCATGCCTCGGGGGTCACTGATGACGCGGTGATCGAGGCGTTG
ACTGCGGAGCAGGTCGGCCGGGTGCTGCGGTCGAAGGTCGATGGGGCGGTCAATCTGCAT
GAGTTGACGCGGGGGCTGGATCTGTCGGCGTTTGTGTTGTTCTCTTCGGCGGCCGGTGTG
TTCGGGAATCCGGGGCAGGGCAACTACGCGGCGGCCAATGCCTTTCTGGATGCGTTGGCG
GTGCGGCGCCGGGCGGAGGGCCTGGCTGCGCGGTCGCTGGCCTGGGGTCTGTGGGAGGAG
GCCAGCGCGATGACGAGCCGGCTGGCCGGGGCCGATCTGGTCCGGATGGGCCGTGCGGGC
CTGCTTCCCCTCACCACCGGGCAAGGGCTCGCCCTCTTCGACGCCGCCCACCGGACAGAC
GAGCCCCTGGTACTGCCGATGAGGCTGGACACCACGGCCCTGCGCTCCACCACCGGACAG
CCGCCGGCGCTGCTGCGCAACCTGGTCCGGGTCCAGGCTCGCCGGACGGCGGGCGCGGCC
CCCGGACCGGACGCGGCCGCCACCTTCCAGCAGCAGCTCATCAGCCTGTCCGTCGCGGAG
CGCGGGCGGGTGCTGCTGGAGACCGTACGCGGCCACGCGGCCGCCGTGCTCGGGCACTCC
GGCCCGGAAGCCGTCGATGTCGACAAGGGCTTCATGGAAGCGGGCTTCGACTCCTTGAGC
GCGGTGGAGTTCCGGAACCGGCTGACGTCCACCACCGGGCTGCGGATGCCGGCCACCGTC
ACGTTCGACTACCCGAGCCCGGCCGCGCTGGCCGAGCACCTGCTGACGCGGTTGGTTCCC
GAGGTCGCCATGCCCGCGGAGGAGCAGCACCCGCACACCCGGCCCGAAGACGGGCCGGTG
GACAGGCCCGGAGACGAACAGGGGGGCGCGATCGACGACATGGACGTCGACAGCCTCGTA
GAACTCGCCCTCGGCGAATGA
[4] KS38..413
[4] AT590..913
[4] malonyl-CoA785..789
[4] DH979..1142
[4] KR1465..1645
[4] ACP1749..1819
[5] KS1840..2217
[5] AT2383..2701
[5] methylmalonyl-CoA not conserved YASHS(S->T)2575..2579
[5] DH2749..2912
[5] KR3246..3426
[5] ACP3532..3602
[6] KS3661..4038
[6] AT4203..4521
[6] methylmalonyl-CoA not conserved YASHS(S->T)4395..4399
[6] KR4844..5019
[6] ACP5126..5196
[7] KS5222..5599
[7] AT5757..6076
[7] malonyl-CoA5952..5956
[7] DH6125..6294
[7] KR6621..6801
[7] ACP6905..6975
[4] KS112..1239
[4] AT1768..2739
[4] malonyl-CoA2353..2367
[4] DH2935..3426
[4] KR4393..4935
[4] ACP5245..5457
[5] KS5518..6651
[5] AT7147..8103
[5] methylmalonyl-CoA not conserved YASHS(S->T)7723..7737
[5] DH8245..8736
[5] KR9736..10278
[5] ACP10594..10806
[6] KS10981..12114
[6] AT12607..13563
[6] methylmalonyl-CoA not conserved YASHS(S->T)13183..13197
[6] KR14530..15057
[6] ACP15376..15588
[7] KS15664..16797
[7] AT17269..18228
[7] malonyl-CoA17854..17868
[7] DH18373..18882
[7] KR19861..20403
[7] ACP20713..20925

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [586-715]  G3DSA:3.40.366.10 [785-902]  G3DSA:3.40.366.10 [2379-2506]  G3DSA:3.40.366.10 [2575-2691]  G3DSA:3.40.366.10 [4199-4326]  G3DSA:3.40.366.10 [4395-4511]  G3DSA:3.40.366.10 [5752-5882]  G3DSA:3.40.366.10 [5952-6067]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [5154-5169]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1747-1822]  1.5e-91 G3DSA:1.10.1200.10 [3530-3605]  1.5e-91 G3DSA:1.10.1200.10 [5125-5198]  1.5e-91 G3DSA:1.10.1200.10 [6905-6978]  1.5e-91 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1742-1857]  1.50000306971104e-28 SSF47336 [3524-3619]  1.20000117458134e-22 SSF47336 [5119-5239]  4.09999599045784e-26 SSF47336 [6897-6992]  2.10000267834031e-21 SSF47336
SSF47336   ACP_like
 [1752-1818]  1.9e-11 PF00550 [3535-3601]  7.30000000000002e-12 PF00550 [5129-5195]  1.8e-10 PF00550 [6908-6974]  2.7e-10 PF00550
PF00550   PP-binding
 [1749-1819]  PS50075 [3532-3602]  PS50075 [5126-5196]  PS50075 [6905-6975]  PS50075
PS50075   ACP_DOMAIN
IPR013968 Polyketide synthase, KR (Domain)
 [1465-1643]  1.99999999999999e-62 PF08659 [3246-3425]  3.80000000000003e-63 PF08659 [4844-5018]  4.70000000000003e-59 PF08659 [6621-6800]  8.79999999999995e-61 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [38-288]  4.80000000000003e-99 PF00109 [1840-2091]  2.90000000000003e-94 PF00109 [3661-3912]  1.79999999999997e-101 PF00109 [5222-5473]  2.20000000000002e-99 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [296-413]  1.2e-46 PF02801 [2099-2217]  2.89999999999999e-45 PF02801 [3920-4038]  1.9e-48 PF02801 [5481-5599]  2.70000000000002e-46 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [590-913]  3.99999999999998e-69 PF00698 [2383-2701]  7.20000000000003e-104 PF00698 [4203-4521]  1.29999999999998e-104 PF00698 [5757-6076]  2.90000000000003e-66 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [6-31]  3.5e-08 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [587-884]  2.0000139277205e-72 SSF52151 [2381-2685]  2.2999842048857e-68 SSF52151 [4201-4504]  8.29994113369276e-67 SSF52151 [5754-6061]  1.39999277195148e-71 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [717-784]  1.20000117458134e-17 SSF55048 [2509-2574]  4.09999599045784e-18 SSF55048 [4329-4394]  4.09999599045784e-18 SSF55048 [5884-5951]  1.20000117458134e-16 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [38-299]  G3DSA:3.40.47.10 [300-464]  G3DSA:3.40.47.10 [1843-2103]  G3DSA:3.40.47.10 [2104-2269]  G3DSA:3.40.47.10 [3661-3923]  G3DSA:3.40.47.10 [3924-4090]  G3DSA:3.40.47.10 [5225-5485]  G3DSA:3.40.47.10 [5486-5651]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [30-412]  1.19999063421924e-103 SSF53901 [1833-2215]  9.80000272130214e-101 SSF53901 [3654-4090]  2.89997807423186e-105 SSF53901 [5222-5597]  1.19999063421924e-103 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1465-1653]  G3DSA:3.40.50.720 [3246-3446]  G3DSA:3.40.50.720 [4844-5025]  G3DSA:3.40.50.720 [6622-6802]  G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [201-217]  PS00606 [3825-3841]  PS00606 [5386-5402]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [591-894]  9.40003071030835e-128 SM00827 [2385-2682]  1.39999277195148e-120 SM00827 [4205-4503]  2.80000504261099e-119 SM00827 [5758-6058]  3.80004034907079e-129 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1750-1822]  1.40000506907309e-34 SM00823 [3533-3605]  6.29998179434732e-34 SM00823 [5127-5199]  5.20000089003336e-33 SM00823 [6906-6978]  2.1000026783403e-34 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [979-1142]  3.30001976117415e-77 SM00826 [2749-2912]  1.39999277195148e-84 SM00826 [6125-6294]  2.59998233910302e-82 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [40-466]  SM00825 [1843-2269]  SM00825 [3664-4090]  SM00825 [5225-5651]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1465-1645]  1e-60 SM00822 [3246-3426]  6.39998633403535e-63 SM00822 [4844-5019]  4.19999771339582e-52 SM00822 [6621-6801]  9.30000048475975e-61 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit