close all open/close all

CDS information : Pladi_00050


close this sectionLocation

Organism
StrainMer-11107
Entry namePladienolide
Contig
Start / Stop / Direction65,707 / 66,906 / + [in whole cluster]
65,707 / 66,906 / + [in contig]
Location65707..66906 [in whole cluster]
65707..66906 [in contig]
TypeCDS
Length1,200 bp (399 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productcytochrome P450
Product (GenBank)cytochrome P450
Gene
Gene (GenBank)pldB
EC number
Keyword
  • C-6 hydroxylate
Note
Note (GenBank)
Reference
ACC
PmId
[18997414] Organization of the biosynthetic gene cluster for the polyketide antitumor macrolide, pladienolide, in Streptomyces platensis Mer-11107. (Biosci Biotechnol Biochem. , 2008)

close this sectionSequence

selected fasta
>cytochrome P450 [cytochrome P450]
MDLETQLLSPAYLRNPHPLNAALRSADPVQRAVASGGLSVWVVTRYEDVRALLADSRLGK
GVTQLREAVLLNAGDDERISQFTDSLTEHMLNSDPPDHTRLRRLVGKAFTAGRIEQLRPR
ITEIVDNLLDRLSPGQEVDLVPVFALPMPTTVICELLGVPSVDRSSFSHWSNVLVSTAEV
GELAEAGGAMVAYLAQLIADKRANPCDDLLTKLVQATDNGDQLSETELVATAFLLLSAGH
ETTVNLIAAGTLTLLQNPDQLARLRSDLTLLPGAIEELIRYDGPGGMVLRHTLEPVEVGG
VTIPAQQVVLLSLSSAGRDSTRFSDADRLDIGRPIGGSVGFGHGIHHCIGAPLARLEGEI
AFRALLTRFPDLRLAVPPEELNWRDSVFIRGPESLPVVL
selected fasta
>cytochrome P450 [cytochrome P450]
ATGGATCTGGAAACCCAACTTCTCTCCCCGGCATACCTACGGAACCCGCACCCGCTCAAC
GCCGCATTGCGTTCCGCCGACCCTGTTCAACGTGCCGTGGCTTCGGGGGGCCTGTCCGTC
TGGGTGGTGACCCGCTACGAGGACGTGCGCGCGCTGCTCGCCGATTCCAGGCTGGGCAAA
GGCGTCACGCAGCTCCGCGAGGCGGTACTGCTCAACGCGGGTGACGACGAGCGGATCAGC
CAGTTCACCGACTCCCTCACCGAGCACATGCTCAACAGCGACCCACCCGACCACACCCGG
CTGCGCCGCCTGGTCGGCAAGGCGTTCACCGCCGGCCGCATAGAACAGCTTCGCCCCAGG
ATCACGGAGATCGTCGACAATCTACTGGACCGGCTGAGTCCCGGTCAGGAGGTCGACCTC
GTCCCTGTCTTCGCCCTGCCCATGCCGACCACTGTGATCTGCGAACTGCTCGGCGTGCCG
TCCGTCGACCGGTCGTCGTTCAGCCACTGGTCCAATGTGCTGGTGTCGACCGCGGAAGTC
GGCGAACTGGCCGAGGCCGGCGGAGCGATGGTCGCCTATCTGGCACAGCTCATCGCGGAC
AAACGCGCCAACCCCTGTGACGACCTGCTCACCAAGCTGGTGCAAGCCACCGACAACGGC
GACCAGCTCTCCGAGACGGAACTCGTGGCGACGGCCTTCCTGCTGCTGTCCGCCGGGCAC
GAGACCACGGTGAACCTCATTGCCGCCGGTACGCTCACTCTGCTCCAGAACCCGGACCAG
CTCGCCCGGTTGCGCTCCGACCTCACGCTGCTGCCCGGCGCGATCGAGGAGCTCATACGG
TACGACGGGCCCGGCGGCATGGTGCTCCGGCACACCCTGGAGCCGGTCGAGGTCGGCGGT
GTGACCATCCCGGCCCAGCAGGTCGTCCTGCTCTCGCTGTCCTCGGCGGGCCGCGACTCC
ACCCGGTTCAGCGACGCCGACCGGCTCGACATCGGCCGTCCCATCGGGGGCAGCGTGGGG
TTCGGGCACGGTATCCACCACTGCATCGGCGCCCCGCTCGCCAGGCTGGAGGGCGAGATC
GCGTTCCGGGCCCTGCTCACCCGCTTCCCCGACCTGCGGCTCGCGGTCCCGCCGGAGGAG
CTGAACTGGCGCGACAGTGTCTTCATCCGCGGCCCGGAATCGCTGCCCGTGGTGCTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [6-399]  1.79999999999997e-116 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [204-369]  4.10000000000001e-22 PF00067
PF00067   p450
 [5-399]  4.80002938964645e-105 SSF48264
SSF48264   Cytochrome_P450
IPR002397 Cytochrome P450, B-class (Family)
 [93-104]  2.69998997787809e-55 PR00359 [139-155]  2.69998997787809e-55 PR00359 [156-171]  2.69998997787809e-55 PR00359 [192-214]  2.69998997787809e-55 PR00359 [273-284]  2.69998997787809e-55 PR00359 [290-317]  2.69998997787809e-55 PR00359 [318-333]  2.69998997787809e-55 PR00359 [339-348]  2.69998997787809e-55 PR00359 [348-359]  2.69998997787809e-55 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [341-350]  PS00086
PS00086   CYTOCHROME_P450
SignalP
 [1-21]  0.149 Signal
Bacteria, Gram-negative   
TMHMM No significant hit