close all open/close all

CDS information : Pladi_00060


close this sectionLocation

Organism
StrainMer-11107
Entry namePladienolide
Contig
Start / Stop / Direction68,160 / 66,967 / - [in whole cluster]
68,160 / 66,967 / - [in contig]
Locationcomplement(66967..68160) [in whole cluster]
complement(66967..68160) [in contig]
TypeCDS
Length1,194 bp (397 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative acyltransferase
Product (GenBank)putative acyltransferase
Gene
Gene (GenBank)pldC
EC number
Keyword
  • C-7
Note
Note (GenBank)
Reference
ACC
PmId
[18997414] Organization of the biosynthetic gene cluster for the polyketide antitumor macrolide, pladienolide, in Streptomyces platensis Mer-11107. (Biosci Biotechnol Biochem. , 2008)
Related Reference
ACC
P96208
PmId
[15070765] Mycobacterial polyketide-associated proteins are acyltransferases: proof of principle with Mycobacterium tuberculosis PapA5. (Proc Natl Acad Sci U S A. , 2004)

close this sectionSequence

selected fasta
>putative acyltransferase [putative acyltransferase]
MALCTVRGDTNEQLLQRAFASSVAAHPSLRSRISPDGTELVLHPLDDGPPELVVRRAGSW
DLDREMRSRLDRCGPLVRATLLRGAAEDTFILHVDHRICDGRSVVALLSAVWRTYAALGE
GPMASSAHVADSYPAPIETRLGHHPEADVLAYAARRAEQAKRLPPVLLPYLGDPGVEAPE
QGEIHVRTLRLTSDETTRLAGSARAAGISVQGLVAAALLIAVRRALEATDAPLSLALASP
VDFRHRVTPPLAEETLVLAAASFYDIVEVSPRADVRTLGRLVYDRLRAGVERGDPEREIL
AVRHFFENPALLAASLVLTNLGRVADLVAPPGLELGGLRWIPVPENWSPEQGRGPLVVSA
ITVEGRLALEVPYSPSCFGHRQIAEVVESTRRILMSA
selected fasta
>putative acyltransferase [putative acyltransferase]
ATGGCGCTGTGCACGGTACGGGGCGATACCAACGAACAGCTTCTCCAACGGGCCTTCGCC
TCGTCCGTGGCCGCGCACCCCTCCTTGCGGAGCCGGATATCGCCGGACGGTACCGAGTTG
GTGCTGCACCCGCTGGACGACGGGCCGCCCGAACTCGTCGTCCGCCGGGCCGGCTCCTGG
GACCTCGACCGGGAGATGCGGAGCCGGCTGGACCGCTGCGGCCCGCTGGTCCGCGCCACC
CTGCTGCGCGGCGCGGCGGAGGACACCTTCATACTCCATGTCGATCACCGGATCTGCGAC
GGCCGCAGCGTGGTCGCCTTGCTGTCGGCGGTGTGGCGGACGTACGCCGCGCTGGGCGAA
GGGCCGATGGCGTCCTCGGCACACGTGGCCGACAGCTACCCGGCGCCCATCGAGACCCGT
CTCGGCCATCACCCGGAGGCGGATGTCCTCGCCTACGCGGCCCGCCGGGCCGAGCAGGCG
AAGCGCCTTCCCCCCGTGCTGCTGCCCTATCTGGGGGACCCGGGCGTGGAAGCGCCGGAG
CAGGGCGAGATACACGTAAGGACCCTCCGGCTCACTTCCGACGAGACGACGCGGCTCGCC
GGATCCGCCCGGGCCGCCGGGATCTCGGTACAGGGCCTGGTGGCGGCGGCACTGCTCATC
GCGGTGCGCCGCGCCCTCGAAGCGACCGACGCACCCCTTTCGCTGGCCTTGGCGTCCCCC
GTCGACTTCCGGCACCGGGTCACTCCACCGCTGGCAGAGGAGACCCTGGTGCTGGCCGCC
GCGTCGTTCTACGACATTGTCGAAGTCTCCCCGCGGGCGGATGTGCGCACGCTCGGCCGG
CTGGTCTACGACCGGCTTCGCGCGGGTGTCGAGCGGGGCGATCCCGAACGCGAGATCCTC
GCGGTGCGCCACTTCTTTGAGAATCCCGCTCTGCTGGCGGCCAGTCTCGTGCTCACCAAC
CTGGGCCGTGTCGCGGACCTGGTGGCACCCCCCGGGCTCGAGCTGGGCGGTTTGCGGTGG
ATCCCGGTACCGGAGAACTGGTCGCCGGAGCAGGGGCGGGGGCCGCTGGTGGTGTCGGCG
ATCACCGTGGAGGGCCGGCTGGCCCTGGAAGTCCCGTATTCGCCCAGCTGCTTCGGGCAT
CGGCAGATCGCCGAGGTAGTCGAAAGCACCCGTCGGATCCTCATGTCGGCGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001242 Condensation domain (Domain)
 [6-230]  9.9e-13 PF00668
PF00668   Condensation
SignalP No significant hit
TMHMM No significant hit