close all open/close all

CDS information : Pladi_00070


close this sectionLocation

Organism
StrainMer-11107
Entry namePladienolide
Contig
Start / Stop / Direction69,661 / 68,267 / - [in whole cluster]
69,661 / 68,267 / - [in contig]
Locationcomplement(68267..69661) [in whole cluster]
complement(68267..69661) [in contig]
TypeCDS
Length1,395 bp (464 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative epoxidase
Product (GenBank)putative epoxidase
Gene
Gene (GenBank)pldD
EC number
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
PmId
[18997414] Organization of the biosynthetic gene cluster for the polyketide antitumor macrolide, pladienolide, in Streptomyces platensis Mer-11107. (Biosci Biotechnol Biochem. , 2008)
Related Reference
ACC
Q846W9
NITE
Monen_00220
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)

close this sectionSequence

selected fasta
>putative epoxidase [putative epoxidase]
MDMVNRAIVLGSGLAGALTASVLAKFVDEVVMLDRDQVPDGPEVRKGTPQTLHSHILMSN
GARTIDSLVPGSLHRLLAAGAHRTEVPSGLVSCSRQGWARRMPGAQFMVTCGRPLLDWTL
RRLVLEDDRITLRSGVDVQGLDGDATRVTGVQAQDRASGESLRLDADFVVDATGRGSGAN
TWLQALGLPAVREVKIDIGLSYATRRYRAPAGAESGFPIVNVLPDPEDDQPGQGAVLLPI
EDGQWIVTLTGTRGCEPPRDPEGFVAFARRLRHSVIGDLIANAEPIGPIHSSRTTVNRRR
YYEELADWPKGFVVLGDAAAALNPVYGHGMSVAAMSASALRDVLRSDGLVAGTSRATQAA
VAGAVNNAWAMATGQDIFYPNVSGRRPGLAARMQRRYVNRVTKTAADRPRVAAAVSDTFT
LSAPLTRLMTPRIVFETLLGPTRPPLTGPPLTSRERESIVGSPQ
selected fasta
>putative epoxidase [putative epoxidase]
ATGGATATGGTGAATCGCGCAATAGTTCTCGGCAGCGGTCTGGCTGGTGCCCTTACGGCA
TCCGTGCTCGCGAAGTTCGTGGACGAGGTAGTGATGCTGGACCGGGACCAGGTACCGGAC
GGCCCGGAAGTCAGAAAGGGCACCCCACAGACCCTCCACTCGCACATCCTGATGTCGAAC
GGCGCACGGACCATCGACTCGCTGGTGCCCGGGAGCCTCCACCGCCTGCTGGCCGCCGGT
GCGCACCGGACCGAGGTACCCAGCGGGCTCGTCTCCTGCTCACGGCAGGGGTGGGCCCGA
AGGATGCCCGGCGCCCAGTTCATGGTCACCTGTGGTCGTCCGCTGCTGGACTGGACGCTG
CGGCGCCTCGTCCTGGAAGACGACCGCATCACCCTGCGGAGCGGTGTTGACGTCCAGGGG
CTCGACGGCGATGCCACCCGGGTGACCGGGGTCCAGGCCCAGGACCGGGCGTCCGGGGAA
TCGCTCCGGCTGGACGCGGACTTCGTGGTGGACGCCACCGGCCGTGGATCCGGCGCGAAC
ACCTGGCTCCAGGCGCTCGGTCTGCCCGCCGTGCGCGAGGTGAAGATCGACATCGGGCTC
TCCTACGCCACCCGCCGGTACCGCGCGCCGGCCGGGGCGGAGAGCGGCTTTCCCATCGTG
AACGTGCTGCCGGACCCGGAGGACGACCAGCCGGGCCAGGGCGCGGTGCTGCTGCCGATC
GAGGACGGACAGTGGATCGTCACGCTGACCGGGACCCGTGGGTGCGAGCCGCCGCGTGAT
CCGGAAGGCTTCGTGGCGTTCGCCCGGAGACTGCGGCATTCGGTGATCGGGGACCTCATC
GCGAACGCCGAGCCGATCGGGCCGATCCACAGCAGTCGCACCACGGTCAACCGCCGCCGC
TACTACGAGGAACTGGCCGACTGGCCGAAGGGCTTCGTGGTGCTCGGCGACGCCGCGGCC
GCCCTGAACCCGGTGTACGGGCACGGCATGTCGGTGGCCGCCATGAGCGCTTCGGCGCTG
CGCGACGTCCTGCGGAGCGACGGGTTGGTGGCCGGGACGAGCCGCGCCACACAGGCCGCC
GTCGCGGGCGCCGTCAACAATGCGTGGGCGATGGCCACAGGACAGGACATCTTCTACCCG
AATGTGAGTGGCCGGCGGCCGGGGCTGGCCGCGCGGATGCAGCGGCGCTATGTCAACCGG
GTGACCAAGACCGCAGCCGACCGCCCCCGGGTGGCCGCCGCGGTGTCGGACACGTTCACC
CTGTCGGCCCCGCTGACCCGGCTGATGACGCCCCGGATCGTCTTCGAGACCCTTCTCGGC
CCTACCCGGCCGCCGCTCACCGGGCCCCCTCTCACCTCCCGGGAACGGGAATCCATCGTC
GGCTCGCCCCAGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM
 [7-24]  Transmembrane (i-o)
Transmembrane 1