close all open/close all
Pladi_00070 Pladi_00070   last last

CDS information : Pladi_00080


close this sectionLocation

Organism
StrainMer-11107
Entry namePladienolide
Contig
Start / Stop / Direction72,725 / 70,017 / - [in whole cluster]
72,725 / 70,017 / - [in contig]
Locationcomplement(70017..72725) [in whole cluster]
complement(70017..72725) [in contig]
TypeCDS
Length2,709 bp (902 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
ProductLuxR family transcriptional activator
Product (GenBank)transcriptional regulator
Gene
Gene (GenBank)pldR
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18997414] Organization of the biosynthetic gene cluster for the polyketide antitumor macrolide, pladienolide, in Streptomyces platensis Mer-11107. (Biosci Biotechnol Biochem. , 2008)
[20133795] Genome-minimized Streptomyces host for the heterologous expression of secondary metabolism. (Proc Natl Acad Sci U S A. , 2010)
Related Reference
ACC
Q9S0N8
NITE
Aver_00010
PmId
[10449723] Organization of the biosynthetic gene cluster for the polyketide anthelmintic macrolide avermectin in Streptomyces avermitilis. (Proc Natl Acad Sci U S A. , 1999)
[19148632] Characterization of a regulatory gene, aveR, for the biosynthesis of avermectin in Streptomyces avermitilis. (Appl Microbiol Biotechnol. , 2009)
[20012992] The pathway-specific regulator AveR from Streptomyces avermitilis positively regulates avermectin production while it negatively affects oligomycin biosynthesis. (Mol Genet Genomics. , 2010)

close this sectionSequence

selected fasta
>LuxR family transcriptional activator [transcriptional regulator]
MHLFGRDSELDLLKSLLVECEIGKAVTVVLEGGAYCGKSELLVNFGEHVKASGAVVVNAR
DLGFDNVPRMSSMSSAQTAEFVEFCGRLEALADRSPVVVCLDDLQDLDSLSWRWLLEATR
ARLRSSRLMLIVVQALRTSLGPEFHCELLRQPNLHRIALRPMTRDHVVDLVGALEGRPAE
DTFLDDVFRLSGGNPLLVRALLEEHRVRNAAGQTAPWPAADGLFAQAAVNCVQGNDPAVV
SLATGIAVLGEDSRPELLEELLGLNAAEIARGILALASAGLVDGYRFQHPLVERATLNII
GPKQRAELRHRAAELLSRHGVGSRTIARHLLEAGSATEPWHVGALRHAAEEALDSDDAEQ
AGAYLELAHDASTDSWERGHIRLKRALVRWRVDPCSVERHHLDGYCGERAPGPELCPVDA
VLLIQLLVSLGRVEEAGELLREVRPTLRGLRSTTDLTVVGNTWLWFFPPMTGMPAAWCAG
SRALADGLSGKDCADGTSRSDALGALATWIKELGRKPGDIQDSEKLLRTTPLSDMTLSLI
LTELNSLTRVGRLDLAATWCDVFLKNATVRGIPGWQRLFAAVRADIALRQGKLTEAETFA
WMSLDGLAEPSSTWLHGGPLTVLMTVYTEMGRYKDVAHLLDRPVPEALFRSVYGLPYLRA
RGHYALAVNRPHLALSDFLSIGRLAERWGLAPSAELPWQVDSAHAWLRLNDREQAERMLA
EYDSATAGIGAATDGAVLRVRAMFAEPGERTRLLIQAAERLQETGDRLQLAKVLADLAST
YEELGVGRRADAIRHMARQIAGDCSAEVPSEPIGSSHRPSPEGGMSSALEFRGADVGANL
SESERRVAALAAKGLTNREISAKLFITMSTVEQHLTRVYRKLDITRREELPLELQLALPQ
TA
selected fasta
>LuxR family transcriptional activator [transcriptional regulator]
ATGCATCTCTTCGGGCGGGACTCGGAACTTGATCTACTGAAATCCTTGCTTGTCGAATGC
GAGATCGGCAAGGCTGTGACCGTGGTATTGGAGGGCGGTGCCTACTGCGGGAAAAGCGAA
TTACTGGTAAATTTCGGCGAGCATGTGAAGGCCTCCGGAGCGGTCGTGGTGAACGCCCGC
GACCTTGGATTCGACAATGTTCCCAGGATGAGCTCGATGAGTTCGGCACAAACCGCCGAG
TTCGTGGAGTTCTGCGGCCGACTCGAGGCCCTGGCCGACCGGTCACCGGTGGTCGTCTGC
CTCGACGACCTACAGGATCTCGACAGCCTGAGCTGGCGCTGGCTGCTGGAGGCCACACGG
GCCAGGCTCCGGTCCAGCAGGCTGATGCTGATCGTCGTACAGGCACTCCGCACATCACTC
GGGCCGGAGTTCCACTGCGAGCTCCTGCGGCAGCCCAATCTCCACCGGATCGCGCTGCGC
CCAATGACCCGGGACCATGTCGTCGACCTGGTCGGCGCCCTGGAGGGCCGGCCGGCGGAG
GACACCTTCCTGGACGACGTGTTCCGGCTGAGCGGCGGCAACCCCCTGCTCGTGCGGGCG
CTGTTGGAAGAACACCGGGTCCGCAACGCCGCAGGCCAAACCGCCCCGTGGCCTGCCGCC
GACGGCCTCTTCGCGCAGGCCGCGGTCAACTGCGTGCAGGGCAACGACCCCGCGGTGGTG
TCCCTCGCCACCGGCATCGCGGTCCTGGGCGAGGACTCCAGGCCGGAACTGTTGGAGGAG
CTGCTCGGGCTGAACGCCGCCGAGATCGCGCGCGGTATCCTTGCGTTGGCCTCGGCCGGA
CTGGTCGACGGCTACCGTTTCCAGCACCCCTTGGTCGAGCGCGCGACCCTGAACATCATC
GGCCCCAAGCAGCGCGCCGAACTGCGCCACCGGGCCGCGGAACTGCTGAGTCGGCACGGC
GTCGGCAGCCGTACGATCGCCCGCCACCTGCTCGAAGCGGGCTCGGCGACGGAACCCTGG
CATGTGGGAGCCCTGCGGCACGCCGCCGAGGAGGCGTTGGACTCGGACGACGCCGAACAG
GCCGGCGCGTACCTCGAACTGGCCCATGACGCCTCCACCGACTCCTGGGAGCGGGGCCAC
ATCCGCCTGAAGCGGGCACTCGTCAGGTGGCGCGTCGACCCCTGTTCCGTCGAACGCCAC
CATCTCGACGGCTACTGCGGGGAGCGGGCACCGGGACCCGAGCTCTGCCCCGTCGATGCC
GTTCTGCTGATCCAACTGCTGGTCAGCCTGGGCCGCGTGGAGGAAGCGGGAGAACTGCTG
CGGGAGGTACGGCCCACCCTGCGCGGTCTTCGCAGTACAACGGACCTGACGGTCGTCGGC
AACACGTGGCTGTGGTTCTTCCCCCCGATGACCGGCATGCCGGCGGCCTGGTGTGCCGGA
TCCCGCGCTCTGGCGGACGGTCTGTCCGGAAAGGACTGCGCCGATGGCACCTCCCGCAGC
GACGCGCTGGGGGCGCTGGCCACTTGGATCAAGGAGCTGGGACGCAAGCCCGGGGATATC
CAGGACTCGGAGAAACTGCTGCGGACCACGCCGCTGTCCGACATGACGCTCAGCCTCATC
CTCACCGAGCTGAACTCGCTCACGCGGGTCGGCCGGCTGGATCTGGCGGCTACGTGGTGC
GACGTTTTCCTGAAGAACGCGACCGTGCGGGGTATCCCGGGCTGGCAACGGCTGTTCGCC
GCCGTGCGAGCCGATATCGCGCTGAGACAGGGCAAGCTGACCGAGGCCGAGACGTTCGCA
TGGATGTCCCTGGACGGCCTCGCCGAACCGTCCAGCACCTGGCTGCACGGCGGCCCGCTG
ACCGTCCTGATGACTGTCTACACCGAGATGGGACGTTACAAGGACGTCGCTCATCTGCTG
GACCGCCCGGTTCCCGAGGCGCTGTTCCGGAGTGTCTACGGGCTCCCGTATCTCCGTGCC
CGCGGCCACTACGCCCTGGCCGTCAACCGGCCCCACCTCGCGCTCTCCGACTTCCTCAGC
ATCGGCCGGCTCGCGGAGCGCTGGGGTCTGGCTCCGTCGGCAGAACTGCCCTGGCAGGTG
GACTCCGCCCATGCCTGGCTCCGGCTCAACGATCGGGAGCAGGCGGAACGGATGCTGGCC
GAGTACGACAGCGCGACGGCCGGCATAGGCGCGGCGACGGACGGTGCAGTGCTGCGCGTC
CGCGCGATGTTCGCCGAGCCGGGCGAACGGACACGACTGCTCATCCAGGCTGCCGAGCGG
TTACAGGAGACCGGGGACCGGCTGCAACTGGCCAAGGTCCTCGCTGACCTGGCGTCCACC
TACGAGGAACTGGGCGTGGGCAGGCGTGCCGACGCCATCCGCCATATGGCGCGGCAGATC
GCAGGCGATTGCAGTGCGGAGGTCCCGTCCGAGCCGATCGGCTCCAGCCATCGTCCCTCC
CCCGAGGGTGGCATGTCCTCGGCGCTCGAATTCCGCGGAGCGGACGTCGGCGCCAATCTG
AGCGAGTCCGAGCGCCGAGTTGCCGCACTGGCGGCCAAGGGTCTGACCAACCGTGAAATC
TCGGCCAAGTTGTTCATCACGATGAGCACGGTGGAGCAGCACCTGACCCGCGTGTACCGC
AAGCTCGACATCACCCGCCGGGAGGAGTTGCCTCTCGAGCTCCAGCTGGCCCTGCCCCAG
ACGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [840-854]  2.19999900980708e-09 PR00038 [854-870]  2.19999900980708e-09 PR00038 [870-882]  2.19999900980708e-09 PR00038
PR00038   HTHLUXR
 [833-898]  PS50043
PS50043   HTH_LUXR_2
 [854-881]  PS00622
PS00622   HTH_LUXR_1
 [838-890]  7.59999999999999e-13 PF00196
PF00196   GerE
 [837-894]  1.50000306971104e-20 SM00421
SM00421   HTH_LUXR
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [838-890]  4.5e-18 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [818-890]  3.70000251046782e-14 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit
Pladi_00070 Pladi_00070   last last