close all open/close all
first first   Polk_00020 Polk_00020

CDS information : Polk_00010


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction2 / 358 / + [in whole cluster]
2 / 358 / + [in contig]
Location2..358 [in whole cluster]
2..358 [in contig]
TypeCDS
Length357 bp (118 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative S-adenosylmethionine synthetase(fragment)
putative methionine adenosyltransferase(fragment)
Product (GenBank)PokSAMS
GenepokSAMS
metK
Gene (GenBank)pokSAMS
EC number2.5.1.6
Keyword
  • SAM
Note
Note (GenBank)
  • putative S-adenosylmethionine synthetase
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)
Related Reference
ACC
Q938W7
PmId
[11594346] Influence of ancillary genes, encoding aspects of methionine metabolism, on tylosin biosynthesis in Streptomyces fradiae. (J Antibiot (Tokyo). , 2001)
Family/Domain
FD
IPR022630

close this sectionSequence

selected fasta
>putative S-adenosylmethionine synthetase(fragment) [PokSAMS]
PSKVDRSAAYAMRWVTKNVVAASLARRWEVQVAYAIGKADPVGLLVETFGTATVDPEKIE
NAVSAVFDLRPAALIRDLDLVRPIYAQTAAYGHFGREMPDFTWERTDRVDALRRAAGL
selected fasta
>putative S-adenosylmethionine synthetase(fragment) [PokSAMS]
CCCTCCAAGGTGGACCGTTCGGCGGCCTACGCCATGCGGTGGGTTACCAAGAACGTCGTC
GCCGCCTCGCTCGCGCGCCGCTGGGAGGTCCAGGTCGCCTACGCGATCGGCAAGGCCGAT
CCCGTCGGGCTCTTGGTGGAGACCTTCGGCACCGCGACCGTCGACCCGGAGAAGATCGAG
AACGCCGTCTCGGCGGTCTTCGACCTCCGGCCCGCCGCCCTCATCCGCGACCTCGACCTG
GTGCGGCCGATCTACGCCCAGACCGCGGCCTACGGCCACTTCGGGCGAGAGATGCCGGAC
TTCACCTGGGAGCGCACCGACCGCGTCGACGCGCTGCGCCGGGCCGCCGGTCTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR022630 S-adenosylmethionine synthetase, C-terminal (Domain)
 [2-105]  7.4e-40 PF02773
PF02773   S-AdoMet_synt_C
IPR022636 S-adenosylmethionine synthetase superfamily (Domain)
 [1-111]  3.3e-43 SSF55973
SSF55973   S-adenosylmethionine synthetase
SignalP
 [1-35]  0.357 Signal
Bacteria, Gram-positive   
TMHMM No significant hit
first first   Polk_00020 Polk_00020