close all open/close all

CDS information : Polk_00020


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction395 / 1,375 / + [in whole cluster]
395 / 1,375 / + [in contig]
Location395..1375 [in whole cluster]
395..1375 [in contig]
TypeCDS
Length981 bp (326 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative phosphotransferase
Product (GenBank)PokR3
Gene
Gene (GenBank)pokR3
EC number
Keyword
Note
Note (GenBank)
  • putative kinase
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)
Family/Domain
FD
IPR011611, IPR002173

close this sectionSequence

selected fasta
>putative phosphotransferase [PokR3]
MRIAVTGSIATDHLMAFPGRFVDQLMSEHLEKVSLSFLADTLEIRRGGVAANIAVGLGRL
GLTPVLVGAAGTDFAEYRDWLRANGVDTGSVRVSATRHTARFVCTTDADQNQIATFYAGA
MVEAREIALAGVVERVGGVGLVMVGPDDPEAMLRHTDACRTLGLDFAADPSQQLARLGRE
ETRRLVDGARFLFTNAYEAALLQERTGWSRAEVLERVGSWLVTHGPEGVAVLRSGHPELR
LPAVEAAEVVDPTGAGDGFRAGFLAGAARGWPQERAARLGCALATLVLESLGTQEYKLSA
AELHLRTEQAYGAAAAAEITHDLERR
selected fasta
>putative phosphotransferase [PokR3]
GTGCGCATCGCCGTCACCGGATCCATCGCGACGGACCACCTCATGGCCTTTCCCGGGCGC
TTCGTCGACCAGCTCATGAGCGAGCACCTGGAGAAGGTGTCGCTGTCGTTCCTCGCCGAC
ACGCTGGAGATCAGGCGCGGCGGGGTGGCCGCCAACATCGCCGTGGGCCTCGGCCGCCTC
GGGCTCACTCCGGTCCTGGTGGGCGCGGCCGGCACCGACTTCGCCGAGTACCGCGACTGG
CTGCGCGCCAACGGCGTCGACACCGGGTCGGTGCGGGTGAGCGCCACCCGGCACACCGCC
CGCTTCGTGTGCACCACCGACGCCGACCAGAACCAGATCGCCACCTTCTACGCCGGCGCG
ATGGTCGAGGCACGGGAGATCGCGCTGGCCGGCGTCGTCGAACGGGTCGGCGGCGTCGGC
CTGGTGATGGTGGGACCCGACGACCCCGAGGCCATGCTCCGGCACACCGACGCGTGCCGG
ACACTCGGACTGGACTTCGCGGCCGACCCCTCGCAGCAACTCGCCCGACTGGGACGGGAG
GAGACCCGGCGGCTCGTCGACGGGGCCCGCTTCCTGTTCACCAACGCTTACGAGGCGGCC
CTGCTCCAGGAACGAACGGGCTGGAGCAGGGCCGAGGTCCTCGAACGGGTCGGCAGCTGG
CTCGTCACCCACGGCCCCGAGGGCGTCGCCGTGCTCCGCTCCGGACACCCGGAGTTGCGG
CTGCCCGCGGTCGAGGCGGCCGAGGTCGTGGACCCCACCGGCGCCGGCGACGGCTTCCGC
GCCGGATTCCTGGCCGGCGCCGCACGGGGATGGCCGCAGGAACGGGCCGCCCGGCTCGGG
TGCGCCCTGGCGACCCTCGTGCTGGAGTCCCTCGGCACCCAGGAGTACAAGCTGTCCGCC
GCCGAACTGCACCTGAGGACCGAGCAGGCCTACGGGGCCGCCGCTGCCGCCGAGATCACC
CACGACCTGGAGAGGCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002173 Carbohydrate/puine kinase, PfkB, conserved site (Conserved_site)
 [251-264]  PS00584
PS00584   PFKB_KINASES_2
 [47-71]  PS00583
PS00583   PFKB_KINASES_1
IPR011611 PfkB (Domain)
 [25-295]  2.19999999999997e-45 PF00294
PF00294   PfkB
SignalP No significant hit
TMHMM No significant hit