close all open/close all

CDS information : Polk_00030


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction1,372 / 2,619 / + [in whole cluster]
1,372 / 2,619 / + [in contig]
Location1372..2619 [in whole cluster]
1372..2619 [in contig]
TypeCDS
Length1,248 bp (415 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-3 C-methyltransferase
Product (GenBank)PokS8
Gene
Gene (GenBank)pokS8
EC number2.1.1.-
Keyword
  • alpha-L-axenose
Note
Note (GenBank)
  • putative dNDP-hexose 3-C-methyltransferase
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)
Related Reference
ACC
Q9XC68
PmId
[11180386] Insights into the Branched-Chain Formation of Mycarose: Methylation Catalyzed by an (S)-Adenosylmethionine-Dependent Methyltransferase We are grateful to Dr. Eugene Seno and the Lilly Research Laboratories for their generous gift of the plasmid pHJL311 and to the National Institutes of Health for grants (GM 35 906 and 54 346). H.-w.L. also thanks the National Institute of General Medical Sciences for a MERIT Award. T.M.H. was a trainee of the National Institute of General Medical Sciences (Biotechnology Training Grant: 2 T32 GM08347). (Angew Chem Int Ed Engl. , 2001)
ACC
A4F7P8
PmId
[15610855] Engineering biosynthetic pathways for deoxysugars: branched-chain sugar pathways and derivatives from the antitumor tetracenomycin. (Chem Biol. , 2004)

close this sectionSequence

selected fasta
>putative NDP-hexose C-3 C-methyltransferase [PokS8]
MTIKECRICGNRTLLPILDLGEQALTGIFPRTRDEVVPSVPLELVRCSPDGCGLVQLRHT
ADFGLMYGEGYGYRSGLGEFMIRHLAGKAALLTDLVRPGPDDLVLDIGSNDSTLLRAYPA
DGPTLVGIDPTGENFREYYPEHVRLVPEFFSREVFTGHFGRRKAKIVTSIAMFYDLPRPL
DFMRDVHDILDDDGVWLLEQELQCPRLIESPPAYDVVVPTKHLEYYALRPDSSGWRARTG
LSVIRAELKLPCTAASLCVVLAKNPARHHVDEAGIAAVRAHEAQLGLDTMAPFEAFAHRA
AEYRDGLRAFLDTSREAGRLTLGYGASTKGNVILQYCGITERDLPCIGEVNKDKDGCFTP
GTGIPVVTESEAKSRRPDQLLVLPWIYRDGFVERERAYRESGGKLVFPLPELSIV
selected fasta
>putative NDP-hexose C-3 C-methyltransferase [PokS8]
ATGACGATCAAAGAGTGCCGCATCTGCGGCAACCGCACCCTGCTGCCGATACTCGACCTG
GGCGAACAGGCCCTCACCGGCATCTTCCCCCGCACCCGCGACGAGGTGGTCCCCTCCGTA
CCCCTCGAACTCGTGCGCTGCTCACCGGACGGCTGCGGACTCGTCCAACTGCGGCACACC
GCCGACTTCGGGCTGATGTACGGCGAGGGCTACGGATACCGGTCCGGACTCGGTGAGTTC
ATGATCCGGCACCTCGCGGGCAAGGCCGCCCTGCTCACCGACCTGGTGCGCCCGGGCCCC
GACGACCTCGTCCTGGACATCGGCAGCAACGACTCCACCCTCCTGCGGGCCTACCCCGCG
GACGGACCCACCCTGGTCGGCATCGACCCGACCGGAGAGAACTTCCGCGAGTACTATCCC
GAACACGTCAGGCTCGTTCCCGAGTTCTTCTCCCGCGAGGTCTTCACCGGGCACTTCGGC
CGGCGCAAGGCCAAGATCGTCACCTCGATCGCGATGTTCTACGACCTGCCGCGCCCCCTC
GACTTCATGCGGGACGTCCACGACATCCTCGACGACGACGGGGTGTGGCTGCTGGAACAA
GAGCTACAATGCCCGCGATTGATCGAAAGCCCACCCGCGTACGACGTTGTTGTGCCCACG
AAGCACCTGGAGTACTACGCGCTGCGGCCAGATTCGAGTGGATGGCGGGCGCGCACCGGA
CTGAGCGTCATCCGGGCGGAGCTTAAACTTCCGTGTACGGCGGCAAGCCTCTGCGTCGTG
CTCGCCAAGAACCCCGCACGCCACCACGTCGACGAGGCCGGGATCGCCGCGGTCCGCGCC
CACGAGGCACAGCTGGGTCTGGACACCATGGCCCCCTTCGAGGCCTTCGCCCACCGGGCG
GCCGAGTACCGCGACGGGCTGCGCGCCTTCCTCGACACCTCCCGCGAGGCCGGCCGGCTG
ACCCTCGGGTACGGCGCGTCGACCAAGGGCAACGTCATCCTCCAGTACTGCGGCATCACC
GAACGCGACCTGCCCTGCATCGGCGAGGTCAACAAGGACAAGGACGGCTGCTTCACCCCC
GGCACCGGCATTCCCGTCGTCACCGAGTCCGAGGCCAAGTCCCGGCGGCCCGACCAGCTG
CTCGTGCTGCCCTGGATCTACCGGGACGGCTTCGTCGAACGGGAGCGTGCGTACCGCGAG
AGCGGCGGCAAGCTGGTCTTCCCGCTACCCGAACTCAGCATCGTGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013630 Methyltransferase putative zinc binding domain (Domain)
 [6-68]  2.4e-21 PF08421
PF08421   Methyltransf_13
IPR013691 C-methyltransferase (Domain)
 [256-410]  4.2e-51 PF08484
PF08484   Methyltransf_14
SignalP No significant hit
TMHMM No significant hit