close all open/close all

CDS information : Polk_00040


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction2,700 / 5,897 / + [in whole cluster]
2,700 / 5,897 / + [in contig]
Location2700..5897 [in whole cluster]
2700..5897 [in contig]
TypeCDS
Length3,198 bp (1,065 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator
Product (GenBank)PokR1
Gene
Gene (GenBank)pokR1
EC number
Keyword
  • SARP family
Note
Note (GenBank)
  • putative transcriptional regulator
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)
Related Reference
ACC
Q2MGB3
NITE
Fred_00260
PmId
[18556785] Identification and utility of FdmR1 as a Streptomyces antibiotic regulatory protein activator for fredericamycin production in Streptomyces griseus ATCC 49344 and heterologous hosts. (J Bacteriol. , 2008)

close this sectionSequence

selected fasta
>putative transcriptional regulator [PokR1]
MPTGAAIRILGPLRVRTADGGTADVRGARLQTLVAVLALAAGREVARSDLLEALWDDALP
SAPDNALQALTSRMRRALPGLVVDSSPTGYRLVVRRDDVDALRFESQVSAVAAVRGDHAR
RAAVLRDALDLWHGPALAGLTSTRVVRAHATRLEELRRRAREDRIDAELALGGGPALVAE
LAGLVSEDPFREKLRVQLMHALQTDGRQTEALGVYTEARTLLAETYGIDPSAELHQAYLD
VLRGEVTAAPPRLAPRETRLPVPLTELVGREADVERVRELLDHARLVTVVGPGGVGKTRV
ALEAARRVDERGTQRVVLVELASVADPANVPRTVLDTLGAGEGGLLSAPGFETPEHGPVL
RRLMSLLAGEPALLVLDNCEHLVEAVAETAATLLAHCPDLCVLAAGRQPLGVSGERLHRL
TGLALPKGPTDAPGSPAVRLFADRALAVRPAFTLDGRTVDTVVAICRALDGLPLALELAA
ARLQSLSAEQIRDRLDDRFRLLGAEGRPADGRRRTLRAVMDWTWDLLDDAERTLARRLAV
FAGRVDLPLVERVCAGDGLDPADLDMLLASLVAKSVVQTEETGRRVGYRMPETVRLYAAE
QLAAAGDEAPLRTRHARTLLAIAETAEPGLRRHGQAAELARLSALVDDFHAALRWSLDHA
PDGLALRLVASLEWFWLLGGRRAEAMEWTRRALDLPCDSRPRDRAIVCAVGGLQHGALLG
EEAGVAYLFEALALIQELPEADHPVLVAAGILGSLASGSPELVSEQLRALGGHRDPWIAS
LARMLGARMLANAGQPHAARDELLAALDGFRTLGERLGLTYTLSALAESESARGDHVGAI
GALEEALRAVTELGHAEDRPMLMVRLAVEQARSGRPEAAEAGLLDAAAEASRLGLGETLG
VAHHALGDLRRTQGRTAEARRLLDRALAEVMAHGPGVGYRPAVLTSQGHLAVAESRLPAA
LEACTAALDLARQVDEAQLLAQVLVLAADIALAQAEPKHAAVLLHTAADVRGQPLDADPD
VHRVARATRLALGDDRYGAARPVRPDEIEGLVAGLAGRLAPPQAG
selected fasta
>putative transcriptional regulator [PokR1]
ATGCCCACCGGTGCTGCCATCCGCATCCTCGGACCGCTGCGCGTACGCACGGCGGACGGC
GGGACGGCCGACGTGCGCGGGGCGCGGCTGCAGACACTGGTCGCGGTCCTCGCGCTGGCG
GCGGGCAGGGAAGTGGCGCGCTCCGACCTCCTCGAAGCGCTCTGGGACGACGCCCTGCCG
TCCGCTCCGGACAACGCGCTCCAGGCCCTGACCTCCCGGATGCGGCGCGCCCTGCCCGGG
CTCGTCGTCGACTCCAGCCCCACCGGCTACCGGCTCGTCGTACGGCGGGACGACGTCGAC
GCGCTCCGCTTCGAGTCGCAGGTGTCGGCCGTCGCCGCGGTGCGGGGCGACCACGCGCGG
CGCGCCGCCGTGCTGCGGGACGCCCTCGACCTGTGGCACGGCCCCGCCCTGGCGGGACTC
ACCTCCACCCGGGTGGTGCGCGCCCACGCGACACGGCTCGAAGAGCTCCGCCGCCGCGCC
CGCGAGGACCGGATCGACGCCGAACTCGCCCTGGGCGGCGGGCCCGCGCTCGTCGCCGAA
CTGGCGGGCCTGGTCTCCGAGGACCCGTTCCGCGAGAAGCTGCGCGTCCAGCTCATGCAC
GCCCTGCAGACCGACGGCCGACAGACCGAGGCGCTGGGCGTGTACACGGAGGCGAGAACC
CTGCTCGCCGAGACGTACGGGATCGACCCCTCGGCGGAACTCCATCAGGCGTACCTCGAC
GTCCTGCGCGGCGAAGTCACCGCGGCACCGCCCCGACTCGCGCCGCGCGAGACACGGCTG
CCGGTCCCGCTCACCGAACTCGTCGGCAGGGAGGCCGACGTGGAGCGGGTGCGGGAACTG
CTCGACCACGCCCGGCTGGTGACCGTCGTCGGCCCCGGCGGCGTGGGCAAGACCCGGGTG
GCCCTCGAAGCGGCCCGACGCGTCGACGAGCGCGGCACCCAGCGCGTCGTTCTCGTCGAA
CTCGCCTCGGTCGCCGACCCGGCCAACGTGCCGCGTACCGTCCTCGACACCCTCGGCGCG
GGCGAGGGCGGACTGCTGTCCGCGCCGGGATTCGAGACACCCGAGCACGGGCCCGTGCTG
CGCCGCCTCATGAGCCTGCTGGCGGGCGAACCGGCCCTGCTCGTCCTCGACAACTGCGAA
CACCTCGTGGAAGCCGTCGCGGAGACCGCCGCGACCCTGCTCGCCCACTGCCCCGACCTG
TGCGTCCTCGCCGCCGGCAGACAGCCGTTGGGGGTCAGCGGCGAACGGCTGCACCGGCTC
ACCGGTCTCGCCCTGCCCAAGGGGCCCACGGACGCGCCGGGCTCGCCCGCGGTGCGCCTC
TTCGCCGACCGCGCCCTCGCCGTCCGCCCCGCGTTCACCCTCGACGGGCGCACGGTGGAC
ACGGTGGTCGCGATCTGCCGCGCCCTCGACGGGCTGCCGTTGGCCCTCGAACTCGCCGCC
GCCCGGCTGCAGTCGCTGTCCGCCGAGCAGATACGCGACCGGCTCGACGACCGGTTCCGG
CTGCTGGGCGCCGAGGGCCGGCCGGCCGACGGGCGGCGCCGCACCCTGCGGGCCGTGATG
GACTGGACCTGGGACCTGCTGGACGACGCCGAGCGCACCCTCGCCCGGCGCCTCGCCGTG
TTCGCGGGCCGCGTCGACCTCCCGCTCGTCGAGCGGGTGTGCGCGGGCGACGGACTCGAC
CCCGCCGACCTCGACATGCTGCTCGCCTCCCTCGTCGCCAAGTCCGTCGTGCAGACGGAG
GAGACCGGCCGGCGGGTCGGCTACCGCATGCCCGAGACCGTACGGCTCTACGCCGCCGAG
CAACTCGCCGCGGCAGGGGACGAGGCACCGCTGCGCACGCGCCACGCCCGGACCCTCCTC
GCGATCGCCGAGACCGCCGAACCGGGGCTCCGCCGCCACGGCCAGGCCGCCGAACTCGCC
CGGTTGAGCGCTCTGGTGGACGACTTCCACGCCGCCCTGCGCTGGTCGCTCGACCATGCT
CCCGACGGGCTCGCGCTGCGCCTCGTCGCCTCGCTGGAGTGGTTCTGGCTGCTCGGCGGG
CGCCGCGCGGAGGCCATGGAATGGACACGCCGCGCACTCGACCTGCCGTGCGACAGCCGG
CCCCGGGACCGGGCGATCGTCTGCGCCGTCGGGGGACTTCAGCACGGGGCACTGCTCGGC
GAGGAAGCAGGCGTCGCCTACCTCTTCGAGGCGCTGGCGCTGATCCAGGAGCTCCCGGAA
GCCGACCACCCGGTGCTCGTGGCCGCAGGCATCCTCGGCTCACTCGCCTCCGGCTCCCCT
GAGCTCGTGAGCGAACAACTGCGTGCGCTCGGCGGCCACCGCGACCCCTGGATCGCCTCC
CTCGCCCGGATGCTGGGGGCCCGCATGCTCGCCAACGCCGGACAGCCGCACGCGGCACGG
GACGAACTCCTCGCCGCCCTCGACGGGTTCCGGACCCTCGGCGAGCGCCTCGGCCTGACC
TACACGCTCTCCGCGCTCGCCGAGTCCGAGAGCGCCCGGGGCGACCACGTGGGCGCGATC
GGCGCGCTGGAGGAGGCGCTGCGCGCCGTGACCGAACTGGGCCACGCCGAGGACCGGCCC
ATGCTCATGGTGCGCCTGGCGGTCGAGCAGGCCAGGTCGGGCCGCCCCGAAGCGGCGGAG
GCCGGACTGCTGGACGCGGCGGCCGAGGCGTCCCGGTTGGGCCTCGGCGAGACCCTGGGC
GTCGCCCACCACGCGCTCGGCGACCTGCGCCGTACGCAGGGCCGGACGGCCGAGGCACGC
AGGCTGCTCGACCGGGCCCTCGCCGAGGTCATGGCACACGGCCCCGGCGTCGGCTATCGC
CCTGCAGTCCTCACCAGCCAGGGCCACCTCGCCGTCGCCGAGAGCCGCCTCCCCGCGGCG
CTGGAGGCCTGCACGGCGGCGCTGGACCTCGCCCGGCAGGTCGACGAGGCACAACTGCTG
GCCCAGGTCCTGGTGCTGGCCGCGGACATCGCCCTCGCCCAGGCCGAACCCAAGCACGCG
GCGGTCCTCCTGCACACCGCCGCGGACGTCCGCGGCCAGCCGCTCGATGCCGACCCGGAC
GTCCACCGGGTGGCGCGGGCGACCCGGCTGGCCCTCGGGGACGACCGGTACGGGGCCGCG
CGCCCCGTACGCCCCGACGAGATCGAGGGCCTGGTCGCGGGCCTCGCCGGCCGGCTGGCG
CCACCGCAGGCCGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000767 Disease resistance protein (Family)
 [286-301]  1.9000006847787e-06 PR00364 [366-380]  1.9000006847787e-06 PR00364 [469-483]  1.9000006847787e-06 PR00364
PR00364   DISEASERSIST
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [32-91]  4.20000000000001e-05 PF00486
PF00486   Trans_reg_C
 [22-92]  4.69999810630989e-06 SM00862
SM00862   Trans_reg_C
IPR005158 Bacterial transcriptional activator domain (Domain)
 [99-241]  8.89999999999994e-35 PF03704
PF03704   BTAD
 [99-242]  3.99998544139406e-41 SM01043
SM01043   BTAD
IPR011990 Tetratricopeptide-like helical (Domain)
 [787-913]  5.40000000000001e-13 G3DSA:1.25.40.10 [914-1027]  2.1e-09 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [32-80]  0.00014 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [4-93]  2.2999993566538e-11 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP
 [1-42]  0.675 Signal
Eukaryota   
TMHMM No significant hit