close all open/close all

CDS information : Polk_00050


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction7,088 / 5,940 / - [in whole cluster]
7,088 / 5,940 / - [in contig]
Locationcomplement(5940..7088) [in whole cluster]
complement(5940..7088) [in contig]
TypeCDS
Length1,149 bp (382 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glycosyltransferase
Product (GenBank)PokGT2
Gene
Gene (GenBank)pokGT2
EC number
Keyword
Note
Note (GenBank)
  • putative glycosyltrasnferase
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)
Related Reference
ACC
Q9ZGB8
NITE
Lando_00220
PmId
[11755402] Elucidation of the function of two glycosyltransferase genes (lanGT1 and lanGT4) involved in landomycin biosynthesis and generation of new oligosaccharide antibiotics. (Chem Biol. , 2001)
[16039521] Iteratively acting glycosyltransferases involved in the hexasaccharide biosynthesis of landomycin A. (Chem Biol. , 2005)

close this sectionSequence

selected fasta
>putative glycosyltransferase [PokGT2]
MRVLVVALVPSHLMSMVPVAWALRSAGHEVLVAGGAPVVERAAAAGLSGAVVSEPPGRPV
RRSAAPSGLPGAGPDWALLQERWRQRVDGVLDEHLDVARRWRPDLVLVDPIEFSGLIVAA
ALRVPAVLHRWGPDRISSQSVPRAVEALGEVAARRGVDSGPALPSLVLDPCPPSLQCPEA
SAAQPVRFVPFNGAGSPPRWAPRPDAGRRLCVSFGGETPMLTRPEIWDALIRELAAVRDM
ESVVTAVPHDAAGLPASVHAPGAVPLDLFLGDCDALLHHGGAGTALTGLAFGVPQLVLAQ
SNPSWAAVGERVAARGAGVVLDLDAAMSADSSAGLRATVESVLSAPGYRSAAESLADEIR
RLPAPSDVVPLLAELAAAPVGR
selected fasta
>putative glycosyltransferase [PokGT2]
ATGAGGGTGCTGGTCGTCGCCCTGGTACCGAGTCATCTGATGTCGATGGTCCCGGTCGCC
TGGGCCCTGCGGTCGGCCGGGCACGAGGTCCTGGTCGCCGGCGGCGCTCCCGTGGTGGAG
CGCGCCGCGGCGGCCGGTCTGTCGGGCGCCGTGGTGAGCGAGCCACCGGGCCGGCCGGTA
CGGCGGTCGGCGGCGCCCTCAGGGCTGCCCGGCGCCGGTCCGGACTGGGCGCTGCTCCAG
GAGAGGTGGCGACAGCGCGTCGACGGCGTGCTCGACGAGCATCTGGACGTCGCCCGCCGG
TGGCGGCCGGATCTGGTGCTGGTGGATCCGATCGAGTTCAGCGGTCTGATCGTGGCGGCC
GCCCTGCGGGTGCCGGCCGTGCTGCACCGCTGGGGGCCGGACCGGATCAGCTCCCAGTCC
GTTCCGCGGGCCGTCGAGGCGCTCGGCGAGGTGGCCGCCCGGCGCGGTGTGGACTCGGGT
CCGGCGCTGCCCTCGCTGGTGCTGGACCCGTGCCCGCCGAGTCTGCAGTGCCCGGAGGCC
TCGGCGGCCCAGCCGGTGCGCTTCGTGCCCTTCAACGGGGCGGGTTCACCGCCTCGTTGG
GCGCCGCGGCCGGACGCGGGCAGGCGCCTGTGCGTCAGCTTCGGCGGCGAGACCCCGATG
CTGACGCGGCCGGAGATCTGGGACGCGCTGATCCGTGAGCTCGCCGCCGTGCGGGACATG
GAGTCGGTCGTCACCGCGGTCCCGCACGACGCGGCCGGTCTGCCCGCCTCTGTGCACGCG
CCGGGCGCGGTTCCGCTGGACCTGTTCCTCGGTGACTGCGACGCGCTGCTGCATCACGGC
GGCGCGGGGACGGCCCTGACCGGTCTGGCCTTCGGGGTGCCGCAGCTGGTCCTCGCCCAG
TCGAACCCTTCGTGGGCGGCGGTCGGCGAGCGCGTCGCGGCGCGCGGGGCAGGCGTGGTC
CTCGACCTCGACGCGGCTATGAGTGCGGACTCTTCGGCGGGGCTGCGGGCGACGGTGGAG
TCGGTGCTCTCCGCTCCCGGTTACCGCTCCGCCGCCGAGTCGCTGGCCGACGAGATCAGG
CGGCTCCCGGCGCCGAGCGACGTGGTGCCGTTGCTCGCGGAGCTGGCGGCGGCTCCTGTG
GGCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR010610 Domain of unknown function DUF1205 (Domain)
 [168-254]  3.8e-16 PF06722
PF06722   DUF1205
SignalP
 [1-22]  0.607 Signal
Bacteria, Gram-positive   
 [1-22]  0.998 Signal
Eukaryota   
 [1-22]  0.712 Signal
Bacteria, Gram-negative   
TMHMM No significant hit