close all open/close all

CDS information : Polk_00060


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction7,910 / 7,101 / - [in whole cluster]
7,910 / 7,101 / - [in contig]
Locationcomplement(7101..7910) [in whole cluster]
complement(7101..7910) [in contig]
TypeCDS
Length810 bp (269 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative drug resistance ABC transporter permease protein
Product (GenBank)PokABC2
Gene
Gene (GenBank)pokABC2
EC number
Keyword
Note
Note (GenBank)
  • putative ABC transporter transmembrane component
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)
Related Reference
ACC
O86917
PmId
[9696745] A silent ABC transporter isolated from Streptomyces rochei F20 induces multidrug resistance. (J Bacteriol. , 1998)
ACC
P32011
NITE
Adria_00140
PmId
[1924314] A bacterial analog of the mdr gene of mammalian tumor cells is present in Streptomyces peucetius, the producer of daunorubicin and doxorubicin. (Proc Natl Acad Sci U S A. , 1991)
[9006006] Expression and characterization of DrrA and DrrB proteins of Streptomyces peucetius in Escherichia coli: DrrA is an ATP binding protein. (J Bacteriol. , 1997)
[15709779] Biochemical characterization of domains in the membrane subunit DrrB that interact with the ABC subunit DrrA: identification of a conserved motif. (Biochemistry. , 2005)
[19063901] Translational coupling controls expression and function of the DrrAB drug efflux pump. (J Mol Biol. , 2009)
[20158521] Daunorubicin efflux in Streptomyces peucetius modulates biosynthesis by feedback regulation. (FEMS Microbiol Lett. , 2010)

close this sectionSequence

selected fasta
>putative drug resistance ABC transporter permease protein [PokABC2]
MTAITTTEEAPQVRRRGPGSAVRQSATVAWRQLVQIKHSPETLVEVGIQPVIFVFLFAFV
LAGQMAGSREAYLQFVVPGLIVQSTVLVTARTAIGMNTDVTKGLFDRFRSLPISRTAPLI
GRILADYVMLVWSVVLLLAFGMLLGFRIETNWGQLIPMFLLLLAFSFALSWASVLAGLLS
KDPESVQALAFGLMLPLTFISDAFVRVETMPGWLQAVVKLNPVTMLADSIRGLLVGGPVG
QPVTKTLIAAAVLLVVFAPLALRAYHRER
selected fasta
>putative drug resistance ABC transporter permease protein [PokABC2]
ATGACGGCCATCACCACGACCGAGGAGGCGCCGCAGGTGCGGCGTCGCGGGCCCGGATCC
GCCGTGCGGCAGAGCGCGACGGTGGCCTGGCGACAGCTCGTGCAGATCAAGCACAGCCCG
GAGACGCTGGTGGAGGTCGGCATCCAGCCGGTCATCTTCGTCTTCCTCTTCGCCTTCGTG
CTCGCCGGTCAGATGGCCGGCTCGCGTGAGGCCTATCTGCAGTTCGTCGTCCCGGGGCTG
ATCGTGCAGAGCACCGTCCTGGTCACCGCGCGCACGGCCATCGGGATGAACACCGATGTC
ACCAAGGGTCTCTTCGACCGCTTCCGCAGCCTGCCGATCTCGCGTACGGCACCGCTCATC
GGCAGGATCCTGGCGGACTACGTGATGCTGGTCTGGTCCGTGGTGCTGCTGCTCGCCTTC
GGCATGCTGCTGGGTTTCCGGATCGAGACCAACTGGGGTCAGCTGATCCCGATGTTCCTG
CTGCTCCTGGCGTTCTCGTTCGCGCTGTCCTGGGCCTCGGTGCTGGCCGGGCTGCTCTCC
AAGGACCCGGAGAGCGTGCAGGCCCTGGCCTTCGGGCTCATGCTGCCGCTGACGTTCATC
AGTGACGCCTTCGTGCGGGTGGAGACCATGCCGGGCTGGCTCCAGGCGGTCGTCAAGCTC
AACCCGGTGACCATGCTGGCCGATTCGATCCGCGGTCTCCTGGTCGGCGGTCCGGTGGGG
CAGCCCGTGACGAAGACGCTGATCGCCGCGGCGGTCCTCCTCGTGGTCTTCGCCCCGCTG
GCCCTGCGCGCCTACCACCGTGAACGGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000412 ABC-2 (Family)
 [41-268]  PS51012
PS51012   ABC_TM2
IPR013525 ABC-2 type transporter (Domain)
 [24-234]  3.7e-26 PF01061
PF01061   ABC2_membrane
SignalP
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [43-62]  Transmembrane (i-o) [72-94]  Transmembrane (o-i) [124-146]  Transmembrane (i-o) [156-178]  Transmembrane (o-i) [185-207]  Transmembrane (i-o) [246-265]  Transmembrane (o-i)
Transmembrane 6