close all open/close all

CDS information : Polk_00070


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction8,839 / 7,907 / - [in whole cluster]
8,839 / 7,907 / - [in contig]
Locationcomplement(7907..8839) [in whole cluster]
complement(7907..8839) [in contig]
TypeCDS
Length933 bp (310 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative drug resistance ABC transporter ATP-binding protein
Product (GenBank)PokABC1
Gene
Gene (GenBank)pokABC1
EC number
Keyword
Note
Note (GenBank)
  • putative ABC transporter ATP-binding component
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)
Related Reference
ACC
Q53716
PmId
[8326867] Streptomyces antibioticus contains at least three oleandomycin-resistance determinants, one of which shows similarity with proteins of the ABC-transporter superfamily. (Mol Microbiol. , 1993)
ACC
P32010
NITE
Adria_00130
PmId
[1924314] A bacterial analog of the mdr gene of mammalian tumor cells is present in Streptomyces peucetius, the producer of daunorubicin and doxorubicin. (Proc Natl Acad Sci U S A. , 1991)
[9006006] Expression and characterization of DrrA and DrrB proteins of Streptomyces peucetius in Escherichia coli: DrrA is an ATP binding protein. (J Bacteriol. , 1997)
[15709779] Biochemical characterization of domains in the membrane subunit DrrB that interact with the ABC subunit DrrA: identification of a conserved motif. (Biochemistry. , 2005)
[19063901] Translational coupling controls expression and function of the DrrAB drug efflux pump. (J Mol Biol. , 2009)
[20158521] Daunorubicin efflux in Streptomyces peucetius modulates biosynthesis by feedback regulation. (FEMS Microbiol Lett. , 2010)
[25721665] Characterization of a novel domain 'GATE' in the ABC protein DrrA and its role in drug efflux by the DrrAB complex. (Biochem Biophys Res Commun. , 2015)

close this sectionSequence

selected fasta
>putative drug resistance ABC transporter ATP-binding protein [PokABC1]
MTSAIQARGLAKRFGETAALTSVDLDVEAGTVLGLLGPNGAGKTTVVRILATLLRPDAGQ
AFIHGHDVTKSPDRVREIIGLTGQFAAVDDSLTGVENLLFLGRLLGKSRADARGTALSLL
ERFGLSDAADRTAKTYSGGMRRRLDLAACLVGEPRVIFLDEPTTGLDPNAREPVVDIIRG
EVRRGVTVLLTTQYLEEADQLADDIVVVDQGSVVARGTPETLKREVGRPTLQVRPADGAQ
VDRVAALVSEVIGEHTSDGRVVKARVRDTAAMSAIVRRLDDAGIEVAELSVREPSLDEVF
KQLTVTGAAV
selected fasta
>putative drug resistance ABC transporter ATP-binding protein [PokABC1]
GTGACATCCGCGATCCAGGCCCGTGGTCTGGCCAAACGCTTCGGTGAGACGGCCGCGCTC
ACCTCCGTCGACCTCGATGTCGAGGCGGGGACCGTGCTCGGGCTGCTGGGCCCCAACGGC
GCGGGCAAGACCACGGTCGTCCGTATCCTCGCCACCCTTCTACGGCCCGATGCCGGACAG
GCCTTCATCCACGGCCACGACGTGACCAAGTCCCCGGACCGGGTCCGCGAGATCATCGGC
CTCACCGGCCAGTTCGCGGCGGTCGACGACAGCCTCACCGGCGTCGAGAACCTGCTGTTC
CTCGGCCGGCTGCTGGGCAAGTCCCGTGCCGACGCGCGCGGTACGGCGCTGAGCCTGCTC
GAACGGTTCGGGCTGTCCGACGCGGCGGACCGCACCGCCAAGACGTACTCCGGCGGTATG
CGCAGGCGGCTGGACCTGGCGGCCTGCCTGGTGGGCGAGCCGCGGGTGATCTTCCTGGAC
GAGCCGACCACGGGGCTGGACCCCAATGCCCGCGAACCAGTTGTGGACATCATCCGCGGC
GAGGTCCGGCGCGGGGTGACGGTGCTGCTGACGACCCAGTACCTGGAGGAGGCCGACCAG
CTCGCCGACGACATCGTGGTCGTCGACCAGGGCTCGGTCGTGGCTCGAGGAACCCCTGAG
ACGCTCAAGCGGGAGGTCGGCAGGCCCACTCTCCAGGTGCGTCCCGCGGACGGTGCGCAG
GTGGACCGGGTGGCCGCGCTGGTGTCCGAGGTGATCGGCGAGCACACGAGCGACGGCCGG
GTGGTCAAGGCGCGGGTGCGGGACACGGCGGCGATGTCGGCGATCGTGCGGCGGCTCGAC
GACGCCGGGATCGAGGTCGCCGAACTCTCGGTGCGGGAACCGAGCCTCGACGAGGTCTTC
AAGCAGCTGACAGTGACGGGAGCGGCGGTATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003439 ABC transporter-like (Domain)
 [5-235]  PS50893
PS50893   ABC_TRANSPORTER_2
 [44-164]  3.2e-18 PF00005
PF00005   ABC_tran
IPR003593 AAA+ ATPase domain (Domain)
 [29-212]  1e-15 SM00382
SM00382   AAA
IPR005894 Daunorubicin resistance ABC transporter ATP-binding subunit (Family)
 [12-304]  1.29999999999998e-100 TIGR01188
TIGR01188   DrrA
IPR017871 ABC transporter, conserved site (Conserved_site)
 [136-150]  PS00211
PS00211   ABC_TRANSPORTER_1
IPR025302 Domain of unknown function DUF4162 (Domain)
 [217-302]  2.3e-07 PF13732
PF13732   DUF4162
SignalP No significant hit
TMHMM No significant hit