close all open/close all

CDS information : Polk_00080


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction9,073 / 10,266 / + [in whole cluster]
9,073 / 10,266 / + [in contig]
Location9073..10266 [in whole cluster]
9073..10266 [in contig]
TypeCDS
Length1,194 bp (397 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glycosyltransferase
Product (GenBank)PokGT1
Gene
Gene (GenBank)pokGT1
EC number
Keyword
Note
Note (GenBank)
  • putative glycosyltransferase
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)
Related Reference
ACC
Q194Q0
NITE
Mith_00250
PmId
[10660060] Characterization of two glycosyltransferases involved in early glycosylation steps during biosynthesis of the antitumor polyketide mithramycin by Streptomyces argillaceus. (Mol Gen Genet. , 2000)
[22997042] Cooperation of two bifunctional enzymes in the biosynthesis and attachment of deoxysugars of the antitumor antibiotic mithramycin. (Angew Chem Int Ed Engl. , 2012)
ACC
Q70J68
NITE
Chro_00300
PmId
[16391039] Deoxysugar transfer during chromomycin A3 biosynthesis in Streptomyces griseus subsp. griseus: new derivatives with antitumor activity. (Appl Environ Microbiol. , 2006)

close this sectionSequence

selected fasta
>putative glycosyltransferase [PokGT1]
MRVLFTTWAAPGHLFPMVPLAWAFQAAGHDVRVAGPPGCRDAVTRAGLCAVAVGDQDAIA
GLPKPPELAAWGRPARWPHGWSAHLDLLDSGRRRVIRALYEKQCAVAGLMLDDLVDFGRW
WRPDLVVHDVLAMAGPVLAAVLGVPAVGHGWEIGSTLHPPTGDTDSEPLPAYLGLFERFG
ADVTAPAGWVDPCPPSLRPPDGAPVRRLPMRCVPYNGSGPQPDWLARPERPRRVCVTAGV
AGARYRDPGGPDVLALTLESLDSVDAEIVLAPGGPVATDALPGHVRVARDVPFRTLLPTC
DLVVHHGGAGTALTAVVMGVPQLVVPPSPICTEIGHGIARSGAGVMLDRLDSTELLLKTV
TEMLADPGPCREAAGRVASETAALPSPSALAAGLAAS
selected fasta
>putative glycosyltransferase [PokGT1]
ATGCGCGTGCTGTTCACGACCTGGGCGGCACCGGGGCACTTGTTCCCGATGGTTCCGCTG
GCGTGGGCCTTCCAGGCCGCCGGGCACGACGTCCGGGTCGCCGGCCCGCCCGGCTGTCGG
GACGCCGTGACCCGAGCCGGGCTGTGCGCGGTCGCCGTCGGCGACCAGGACGCGATCGCC
GGACTGCCCAAGCCGCCCGAACTGGCCGCCTGGGGCCGCCCGGCCCGGTGGCCACACGGC
TGGTCCGCCCACCTCGACCTCCTGGACAGCGGCCGGCGCCGGGTGATCCGCGCTCTGTAC
GAGAAGCAGTGCGCGGTCGCCGGGCTGATGCTGGACGATCTGGTCGACTTCGGCCGCTGG
TGGCGGCCGGACCTGGTCGTCCACGACGTGCTGGCCATGGCCGGGCCGGTGCTGGCCGCC
GTGCTCGGGGTCCCCGCGGTCGGCCACGGCTGGGAGATCGGCAGCACCCTGCACCCGCCG
ACCGGCGACACGGACAGCGAGCCGCTGCCCGCCTACCTCGGCCTGTTCGAGCGGTTCGGC
GCCGACGTCACGGCGCCGGCCGGCTGGGTCGACCCGTGCCCTCCGTCGCTGCGGCCCCCG
GACGGAGCGCCCGTGCGGCGGCTGCCCATGCGCTGCGTGCCGTACAACGGTTCGGGTCCC
CAGCCGGACTGGCTCGCGCGGCCCGAGCGCCCCCGCCGGGTGTGCGTGACCGCCGGAGTC
GCGGGCGCACGCTATCGGGACCCCGGCGGCCCCGACGTACTCGCCCTGACGCTGGAGTCG
CTGGACTCCGTCGACGCCGAGATCGTGCTGGCGCCGGGCGGACCCGTCGCGACGGACGCC
CTGCCCGGGCATGTGCGCGTCGCCCGGGACGTCCCGTTCCGCACGCTGCTGCCGACCTGC
GACCTGGTGGTCCACCACGGCGGGGCGGGCACCGCACTCACCGCGGTCGTCATGGGCGTA
CCGCAGCTCGTCGTGCCGCCCTCCCCGATCTGTACGGAGATCGGCCACGGCATCGCCCGC
TCCGGAGCGGGCGTCATGCTGGACCGGCTCGACAGCACCGAACTGCTGCTGAAGACGGTC
ACCGAGATGCTGGCGGACCCCGGTCCCTGCCGGGAGGCCGCCGGCCGGGTGGCCTCGGAG
ACGGCGGCGCTGCCGTCCCCGAGCGCCCTGGCGGCCGGACTCGCGGCGTCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-146]  3.2e-15 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [190-286]  3.2e-21 PF06722
PF06722   DUF1205
SignalP
 [1-26]  0.418 Signal
Bacteria, Gram-positive   
 [1-23]  0.628 Signal
Bacteria, Gram-negative   
 [1-23]  0.983 Signal
Eukaryota   
TMHMM No significant hit