close all open/close all

CDS information : Polk_00100


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction11,296 / 12,594 / + [in whole cluster]
11,296 / 12,594 / + [in contig]
Location11296..12594 [in whole cluster]
11296..12594 [in contig]
TypeCDS
Length1,299 bp (432 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative pyridoxamine 5'-phosphate-dependent NDP-hexose C-3 dehydratase
Product (GenBank)PokS5
Gene
Gene (GenBank)pokS5
EC number
Keyword
  • beta-D-amicetose
Note
Note (GenBank)
  • putative NDP-hexose 3-dehydratase
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)
Related Reference
ACC
Q9ALN8
NITE
Spino_00050
PmId
[17076492] Characterization of SpnQ from the spinosyn biosynthetic pathway of Saccharopolyspora spinosa: mechanistic and evolutionary implications for C-3 deoxygenation in deoxysugar biosynthesis. (J Am Chem Soc. , 2006)
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative pyridoxamine 5'-phosphate-dependent NDP-hexose C-3 dehydratase [PokS5]
MDIRSALLELTRKFHQEQTEDSFVPGQTAILTSGAVLDEEDRVAFVEAALDMTIAAGARA
RTFESRFARAMKARKAHLTNSGSSANLLALSALTSPQLEDARLVPGDEVITVATGFPTTV
NPVLQNGLVPVFVDIELGTYNTTLERVEEAIGPRTRAIMVAHALGNPFPAAEIAELASRH
GLFLVEDNCDAVGSLYQGRLTGTFGDLSTVSFYPAHHLTMGEGGCVLTGNLALARIVESM
RDWGRDCWCEPGEDNRCLRRFDYSFGTLPQGYDHKYVFSHVGYNLKTTDVQAALGLSQLR
RLEEFGAARRRNWQRLRDGLQDVPGLLLPEATPGSDPSWFGFVLTVLPDAPFTRTALVSF
LEDRKIRTRRLFAGNLTRHPAYEGRHFRVVGELTNSDVTTEATFWIGVYPGITPEMVDYM
VASIREFVAAAS
selected fasta
>putative pyridoxamine 5'-phosphate-dependent NDP-hexose C-3 dehydratase [PokS5]
ATGGACATACGCAGCGCACTGCTGGAACTGACCCGGAAATTCCACCAGGAGCAGACCGAG
GACAGCTTCGTCCCCGGACAGACGGCGATCCTCACCTCGGGCGCGGTGCTGGACGAGGAG
GACCGGGTCGCCTTCGTCGAAGCGGCCCTGGACATGACGATCGCCGCCGGAGCGCGGGCC
CGGACCTTCGAGAGCCGGTTCGCCCGCGCGATGAAGGCGCGCAAGGCACATCTCACCAAC
TCCGGTTCCTCGGCCAACCTCCTCGCGCTCAGCGCCCTCACCTCGCCGCAGCTGGAGGAT
GCCCGGCTGGTCCCCGGCGACGAGGTGATCACGGTCGCGACGGGCTTCCCCACGACCGTC
AACCCGGTGCTGCAGAACGGCCTCGTACCGGTCTTCGTCGACATCGAACTCGGCACGTAC
AACACGACGCTGGAGCGCGTCGAGGAGGCCATCGGGCCGCGGACCCGCGCCATCATGGTC
GCGCACGCGCTCGGCAACCCCTTCCCGGCGGCCGAGATCGCCGAACTCGCCTCCCGGCAC
GGCCTGTTCCTCGTCGAGGACAACTGCGACGCCGTCGGCTCGCTCTACCAGGGCCGGCTC
ACCGGCACCTTCGGCGACCTGTCCACCGTCAGCTTCTATCCCGCCCACCACCTCACGATG
GGGGAGGGCGGCTGCGTACTGACCGGGAATCTGGCGCTCGCGCGGATCGTCGAGTCGATG
CGGGACTGGGGACGCGACTGCTGGTGCGAACCGGGCGAGGACAACCGCTGCCTGCGCCGC
TTCGACTACAGCTTCGGCACGCTCCCGCAGGGATACGACCACAAGTACGTGTTCTCGCAC
GTCGGCTACAACCTCAAGACGACGGACGTCCAGGCGGCCCTCGGCCTGAGCCAGCTGCGC
CGCCTGGAGGAGTTCGGCGCGGCACGGCGGCGCAACTGGCAGCGCCTGCGCGACGGGCTC
CAGGACGTCCCCGGGCTGCTGCTGCCCGAGGCGACGCCCGGCAGCGATCCCAGCTGGTTC
GGCTTCGTCCTCACCGTCCTGCCCGACGCCCCCTTCACCCGCACCGCCCTGGTGTCCTTC
CTGGAGGACCGCAAGATCCGCACCCGGAGGCTGTTCGCGGGCAACCTCACCCGGCATCCC
GCTTACGAGGGACGGCACTTCCGGGTGGTGGGGGAGCTGACCAACAGCGACGTCACCACC
GAGGCGACGTTCTGGATCGGCGTCTACCCCGGCATCACCCCGGAGATGGTGGACTACATG
GTCGCCTCGATACGCGAGTTCGTGGCGGCGGCGTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000653 DegT/DnrJ/EryC1/StrS aminotransferase (Family)
 [39-425]  9.2000000000001e-97 PF01041
PF01041   DegT_DnrJ_EryC1
 [1-432]  1.90000694315261e-110 PIRSF000390
PIRSF000390   PLP_StrS
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [34-301]  2.39999999999997e-69 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [302-425]  3.09999999999998e-47 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [38-431]  6.29998179434741e-91 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit