close all open/close all

CDS information : Polk_00110


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction13,832 / 12,678 / - [in whole cluster]
13,832 / 12,678 / - [in contig]
Locationcomplement(12678..13832) [in whole cluster]
complement(12678..13832) [in contig]
TypeCDS
Length1,155 bp (384 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative FMNH2-dependent monooxygenase
Product (GenBank)PokU2
Gene
Gene (GenBank)pokU2
EC number
Keyword
  • two-component system
Note
Note (GenBank)
  • putative acyl-CoA dehydrogenase
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)
Related Reference
ACC
Q53907
NITE
Actino_00110
PmId
[18245777] Mechanism and regulation of the Two-component FMN-dependent monooxygenase ActVA-ActVB from Streptomyces coelicolor. (J Biol Chem. , 2008)
[19246012] Biosynthesis of actinorhodin and related antibiotics: discovery of alternative routes for quinone formation encoded in the act gene cluster. (Chem Biol. , 2009)
[22086671] Epoxyquinone formation catalyzed by a two-component flavin-dependent monooxygenase involved in biosynthesis of the antibiotic actinorhodin. (Chembiochem. , 2011)
[23601640] Biosynthetic conclusions from the functional dissection of oxygenases for biosynthesis of actinorhodin and related streptomyces antibiotics. (Chem Biol. , 2013)

close this sectionSequence

selected fasta
>putative FMNH2-dependent monooxygenase [PokU2]
MTNATPTAPPADTGLSAAAGKVAELAAEHAAAADSDDRLSATVAEALVSAGFARHLVGPR
WGGSAAAPGAVRDLARALSVVGAGCMSAAWCAGVLAAVGRMCSHLPEEGQAELWGDGPDV
PLAGSLAPSGTVDTVPGGWRLSGTWDFASGVDHAQWTMVGGLVRGPEGPPALRHFVLPRR
DYRVLDTWRNVGLRGTGSNSVVLDDVFVPAHRSFEHRTVLAGDPAPSAPRLHRVPLKLIN
GLFFVAPGIGAVEGALGAWTRWTASRVEINGVRTGSRPGVRLTLARAAAALDAARLIVDH
AAAEADEAEPTPALTLRVTRDYSTAVDLLLDSVNGLMRMSGARGQALSHPVQRVWRDVHC
MAGHAALQPDVNADGWAKHALGEE
selected fasta
>putative FMNH2-dependent monooxygenase [PokU2]
ATGACGAACGCGACGCCCACCGCTCCCCCGGCGGACACCGGTCTGTCGGCGGCCGCGGGC
AAGGTGGCCGAGCTGGCCGCGGAGCACGCGGCGGCCGCGGACTCCGACGACCGGCTGTCC
GCCACCGTCGCCGAGGCCCTGGTGAGCGCCGGATTCGCGCGCCATCTGGTGGGCCCGCGA
TGGGGCGGTTCGGCAGCCGCCCCGGGCGCGGTGCGTGACCTCGCGCGGGCGCTGTCCGTG
GTGGGCGCCGGATGCATGTCGGCGGCCTGGTGCGCCGGGGTGCTCGCCGCCGTGGGCCGC
ATGTGCTCGCACCTGCCCGAGGAGGGGCAGGCGGAACTGTGGGGCGACGGGCCGGACGTA
CCGCTCGCCGGATCGCTGGCACCGTCGGGCACGGTCGACACGGTGCCGGGCGGCTGGCGA
CTGAGCGGCACCTGGGACTTCGCCAGCGGGGTGGACCACGCGCAGTGGACGATGGTGGGC
GGTCTGGTCCGCGGTCCCGAAGGTCCGCCCGCGCTGCGGCACTTCGTGCTGCCGCGCCGT
GACTACCGGGTGCTGGACACCTGGCGCAATGTGGGGCTGCGCGGCACGGGCAGCAACAGT
GTGGTCCTCGACGACGTCTTCGTGCCGGCGCACCGCAGCTTCGAGCACCGTACGGTTCTC
GCCGGCGACCCGGCCCCCTCCGCTCCGCGCCTGCACCGCGTACCGCTCAAGCTGATCAAC
GGCCTGTTCTTCGTGGCCCCCGGCATCGGTGCGGTCGAGGGCGCTCTCGGGGCATGGACC
CGATGGACCGCGAGCCGCGTCGAGATCAACGGCGTCCGGACCGGGTCCCGGCCCGGCGTG
CGCCTGACGCTGGCCCGGGCCGCGGCCGCCCTCGACGCGGCACGGCTGATCGTCGACCAC
GCGGCGGCCGAGGCCGACGAGGCGGAGCCGACCCCGGCCCTGACGCTGCGGGTCACGCGT
GACTACTCGACCGCGGTGGACCTGCTGCTCGACTCCGTGAACGGGCTGATGCGGATGAGC
GGCGCCCGGGGCCAGGCCCTGTCCCACCCGGTTCAGCGGGTGTGGCGGGACGTGCACTGC
ATGGCCGGGCACGCCGCGCTCCAGCCGGACGTGAACGCCGACGGCTGGGCGAAGCACGCG
CTCGGCGAGGAATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006091 Acyl-CoA oxidase/dehydrogenase, central domain (Domain)
 [123-207]  7.4e-28 G3DSA:2.40.110.10
G3DSA:2.40.110.10   Acyl_CoA_DH/ox_M
IPR009075 Acyl-CoA dehydrogenase/oxidase C-terminal (Domain)
 [242-382]  1e-12 SSF47203
SSF47203   AcylCoADH_C_like
 [208-383]  9.09999999999992e-38 G3DSA:1.20.140.10
G3DSA:1.20.140.10   AcylCoA_DH_1/2_C
IPR009100 Acyl-CoA dehydrogenase/oxidase (Domain)
 [1-216]  1.70000295590054e-27 SSF56645
SSF56645   AcylCoA_dehyd_NM
IPR013107 Acyl-CoA dehydrogenase, type 2, C-terminal (Domain)
 [242-369]  1.3e-32 PF08028
PF08028   Acyl-CoA_dh_2
IPR013786 Acyl-CoA dehydrogenase/oxidase, N-terminal (Domain)
 [6-119]  2.6e-22 G3DSA:1.10.540.10
G3DSA:1.10.540.10   AcylCoA_DH/ox_N
SignalP
 [1-32]  0.392 Signal
Bacteria, Gram-positive   
TMHMM No significant hit