close all open/close all

CDS information : Polk_00120


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction14,350 / 13,829 / - [in whole cluster]
14,350 / 13,829 / - [in contig]
Locationcomplement(13829..14350) [in whole cluster]
complement(13829..14350) [in contig]
TypeCDS
Length522 bp (173 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative NADH-dependent FMN reductase
Product (GenBank)PokU2
Gene
Gene (GenBank)pokU1
EC number1.5.1.42
Keyword
  • two-component system
Note
Note (GenBank)
  • dimerase
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)
Related Reference
ACC
Q02058
NITE
Actino_00230
PmId
[7615536] Identification of a flavin:NADH oxidoreductase involved in the biosynthesis of actinorhodin. Purification and characterization of the recombinant enzyme. (J Biol Chem. , 1995)
[18245777] Mechanism and regulation of the Two-component FMN-dependent monooxygenase ActVA-ActVB from Streptomyces coelicolor. (J Biol Chem. , 2008)
[19246012] Biosynthesis of actinorhodin and related antibiotics: discovery of alternative routes for quinone formation encoded in the act gene cluster. (Chem Biol. , 2009)
[22086671] Epoxyquinone formation catalyzed by a two-component flavin-dependent monooxygenase involved in biosynthesis of the antibiotic actinorhodin. (Chembiochem. , 2011)

close this sectionSequence

selected fasta
>putative NADH-dependent FMN reductase [PokU2]
MTTASTGVDRTLLRDSLSRWPSGVAVVTTVDESRAPRGFTATAFSSLSMDPPMVLVCLDR
GADCRPAFETAGVMAVHLLREDQAHLAQRFATKDIDKYEGLPVSAGLGGVPLLGGVVARI
ECVLDRRIDAGDHVILVGLVHRCESFTGAPLVYFARSFHGLQPPTHHREADPS
selected fasta
>putative NADH-dependent FMN reductase [PokU2]
ATGACCACCGCGTCCACCGGCGTCGACCGGACCCTCCTGCGCGACTCGCTGTCCCGGTGG
CCCAGCGGGGTCGCCGTGGTGACCACGGTGGACGAGTCCCGGGCGCCGCGCGGCTTCACC
GCGACGGCCTTCTCGTCACTGTCGATGGACCCGCCGATGGTGCTGGTCTGTCTGGACCGG
GGAGCCGACTGCCGCCCGGCGTTCGAGACGGCCGGCGTGATGGCCGTGCATCTGCTGCGC
GAGGACCAGGCACACCTGGCGCAGCGCTTCGCCACCAAGGACATCGACAAGTACGAAGGG
CTGCCGGTCTCCGCGGGCCTGGGCGGAGTGCCGCTGCTGGGCGGCGTGGTGGCCCGCATC
GAATGCGTGCTCGACCGCCGGATCGATGCCGGGGACCACGTGATCCTCGTCGGTCTGGTG
CACCGCTGTGAGTCGTTCACGGGTGCTCCGCTGGTGTATTTCGCGCGGTCGTTCCACGGC
CTGCAGCCCCCGACCCACCACAGAGAGGCGGACCCCTCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002563 Flavin reductase-like, FMN-binding (Domain)
 [17-160]  5.30001985225035e-53 SM00903
SM00903   Flavin_Reduct
 [18-161]  1e-32 PF01613
PF01613   Flavin_Reduct
IPR009002 FMN-binding split barrel-related (Domain)
 [5-169]  3.1999989904635e-46 SSF50475
SSF50475   FMN_binding
IPR012349 FMN-binding split barrel (Domain)
 [6-159]  5.40000000000002e-51 G3DSA:2.30.110.10
G3DSA:2.30.110.10   PNPOx_FMN_bd
SignalP No significant hit
TMHMM No significant hit