close all open/close all

CDS information : Polk_00130


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction15,348 / 14,347 / - [in whole cluster]
15,348 / 14,347 / - [in contig]
Locationcomplement(14347..15348) [in whole cluster]
complement(14347..15348) [in contig]
TypeCDS
Length1,002 bp (333 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-3 ketoreductase
Product (GenBank)PokS4
Gene
Gene (GenBank)pokS4
EC number
Keyword
  • beta-D-amicetose
  • alpha-L-axenose
Note
Note (GenBank)
  • putative NDP-hexose 3-ketoreductase
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)
Related Reference
ACC
Q9ALN5
NITE
Spino_00080
PmId
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative NDP-hexose C-3 ketoreductase [PokS4]
MVTGRTAPLPVGVLGCGGIAMRRMLPAMARTPEVRVTAIASRDRDRAASAANRFDADPVH
GYERLLERDDITAVYLPLPPALHAPWAARALKAGKHVLVEKPMVTCAGEARDLARLAEEG
RLVLMESFMFLHHSQHATVTELLERGEIGELRQVSAEFGFPPLPAQDIRHRPELGGGALL
DAGVYTLRVTQHLLGGTVSVVGAALTADASTGVDVGGDALLRGGDGVTSHVSFGFRHAYR
SAYTLWGSAGRIVLDRAFTPPPEHRPVLRVERQDRVEELTLAADDQFANIAARFADLVRG
RADPAVERAAAVRQAELVDAVRAAAGPGPGSPP
selected fasta
>putative NDP-hexose C-3 ketoreductase [PokS4]
GTGGTGACCGGGCGGACGGCACCCCTGCCGGTCGGTGTCCTCGGATGCGGCGGCATCGCC
ATGCGCCGCATGCTGCCCGCGATGGCGCGGACCCCGGAGGTCCGCGTCACCGCGATCGCG
AGCCGGGACCGGGACCGCGCCGCGTCGGCGGCGAACCGCTTCGACGCGGACCCCGTGCAC
GGATACGAACGACTCCTGGAACGCGACGACATCACCGCGGTGTACCTACCGCTGCCGCCC
GCGCTGCACGCCCCCTGGGCCGCGCGGGCGCTGAAGGCGGGCAAGCACGTCCTGGTCGAG
AAGCCGATGGTCACCTGCGCCGGGGAGGCGCGCGACCTGGCCCGGCTCGCCGAAGAGGGA
CGGCTCGTGCTGATGGAGAGCTTCATGTTCCTCCACCACTCCCAGCACGCCACCGTCACG
GAGCTGCTCGAACGCGGCGAGATCGGCGAACTGCGCCAGGTGAGCGCCGAGTTCGGCTTC
CCGCCGCTGCCCGCCCAGGACATCCGGCACCGCCCCGAGCTCGGCGGCGGCGCCCTGCTC
GACGCCGGCGTCTACACGCTGCGCGTCACCCAGCACCTGCTCGGCGGGACGGTGTCGGTG
GTCGGCGCGGCCCTGACGGCCGACGCGTCCACGGGCGTGGACGTCGGCGGCGACGCACTG
CTGCGCGGCGGCGACGGCGTCACCTCCCATGTGTCGTTCGGCTTCCGCCACGCCTACCGG
TCGGCGTACACCCTGTGGGGCAGTGCCGGCCGGATCGTCCTCGACCGCGCCTTCACCCCT
CCCCCGGAGCACCGTCCCGTCCTGCGCGTCGAACGGCAGGACCGGGTGGAGGAGCTGACG
CTCGCGGCCGACGACCAGTTCGCCAACATCGCGGCCCGTTTCGCGGATCTGGTGCGAGGC
CGCGCGGATCCGGCGGTGGAGCGCGCGGCGGCCGTGCGGCAGGCCGAGCTGGTGGACGCC
GTGCGCGCGGCGGCCGGCCCGGGTCCGGGAAGTCCGCCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000683 Oxidoreductase, N-terminal (Domain)
 [11-125]  2.4e-25 PF01408
PF01408   GFO_IDH_MocA
IPR004104 Oxidoreductase, C-terminal (Domain)
 [141-244]  4.1e-11 PF02894
PF02894   GFO_IDH_MocA_C
IPR016040 NAD(P)-binding domain (Domain)
 [6-150]  7.59999999999998e-43 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-29]  0.404 Signal
Bacteria, Gram-negative   
 [1-29]  0.768 Signal
Bacteria, Gram-positive   
TMHMM No significant hit