close all open/close all

CDS information : Polk_00140


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction16,772 / 15,342 / - [in whole cluster]
16,772 / 15,342 / - [in contig]
Locationcomplement(15342..16772) [in whole cluster]
complement(15342..16772) [in contig]
TypeCDS
Length1,431 bp (476 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose 2,3-dehydratase
Product (GenBank)PokS3
Gene
Gene (GenBank)pokS3
EC number
Keyword
  • beta-D-amicetose
  • alpha-L-axenose
Note
Note (GenBank)
  • putative dTDP-hexose 2,3-dehydratase
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)
Related Reference
ACC
Q9ALN6
NITE
Spino_00070
PmId
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative NDP-hexose 2,3-dehydratase [PokS3]
MTTERTLTAGGPGPQARFTESGAAAEDRASVKATLAWLTARREAHTFEVTRVPFAELAEW
SFRPDTGDLGHRSGRFFTVEGHRVHTDHGKVPRWDQPIINQPEIGMLGFLVKEIDGVLHC
LMQAKMEPGNVNVVQLSPTVQATRSNQKRVHQGSGVRYLEYFTDPGRARVLVDVLQSEQG
SWFLGKRNRNIVVETTEDVPPHDDYRWMTIGEIQELLRLDNMVNMDARTVLSCVPFARPT
GAPPPGPHGEFRAGLRRSMAPEEGALHSTPSVLSWFADTTARHELRTERIPLNRVEGWNR
TADAISHAEGRHFSIIGARVTAGSREVLNWTQPLLAPHGLGLSALLVRTIGDVTHLLFHA
RPEAGFPHGVELGPTVQCTPDTYRGLPDDHRPPFLDYVTGVPRDRVRFDAVQSEEGGRFH
HAECRYTVIEVEDGFPVEEPEGYRWLTVHQVTGLLRHSHYLNVQARSLVACLHSLW
selected fasta
>putative NDP-hexose 2,3-dehydratase [PokS3]
ATGACCACCGAGCGCACACTCACAGCCGGCGGACCCGGTCCGCAGGCGCGGTTCACCGAG
TCGGGAGCCGCGGCCGAGGACCGGGCGTCGGTCAAGGCCACGCTCGCCTGGCTGACCGCA
CGCAGGGAGGCCCACACCTTCGAGGTCACCCGGGTCCCCTTCGCCGAGCTGGCGGAGTGG
TCCTTCCGGCCTGACACCGGCGATCTCGGCCACCGCAGCGGCCGGTTCTTCACGGTCGAG
GGCCATCGCGTGCACACCGACCACGGGAAGGTGCCCCGCTGGGACCAGCCGATCATCAAC
CAGCCCGAGATCGGCATGCTCGGCTTCCTGGTCAAGGAGATCGACGGCGTCCTGCACTGC
CTGATGCAGGCCAAGATGGAGCCCGGCAACGTCAACGTCGTACAGCTGTCACCGACCGTG
CAGGCGACCCGGAGCAACCAGAAGCGGGTGCACCAGGGTTCGGGCGTCAGGTACCTGGAG
TACTTCACCGATCCCGGGCGGGCACGGGTGCTCGTCGACGTCCTCCAGTCCGAACAGGGC
TCGTGGTTCCTCGGCAAGCGCAACCGCAACATCGTGGTGGAGACGACCGAGGACGTCCCG
CCGCACGACGACTACCGCTGGATGACGATCGGCGAGATCCAGGAACTCCTGCGCCTGGAC
AACATGGTGAACATGGACGCCAGGACCGTCCTGTCCTGTGTGCCGTTCGCCCGGCCCACG
GGAGCGCCGCCGCCCGGTCCGCACGGCGAGTTCCGCGCGGGCCTGCGCCGCTCCATGGCG
CCGGAGGAGGGGGCGCTGCACAGCACGCCGTCGGTGCTGAGCTGGTTCGCCGACACCACG
GCCCGCCACGAACTGCGCACGGAACGCATCCCGTTGAACCGCGTCGAGGGCTGGAACCGC
ACCGCGGACGCGATCAGCCATGCGGAGGGACGGCACTTCTCCATCATCGGCGCCCGGGTG
ACGGCCGGCAGCCGCGAGGTGCTCAACTGGACGCAGCCGCTACTGGCCCCGCACGGCCTG
GGCCTGTCCGCACTGCTGGTGCGCACCATCGGCGACGTGACCCATCTGCTGTTCCACGCC
CGTCCCGAGGCGGGATTCCCGCACGGCGTCGAACTGGGCCCCACCGTGCAGTGCACCCCG
GACACCTACCGGGGGCTGCCCGACGACCACCGGCCGCCGTTCCTCGACTACGTGACCGGC
GTCCCCCGCGACCGGGTGCGCTTCGACGCGGTGCAGTCCGAGGAGGGCGGCCGATTCCAC
CACGCCGAGTGCCGTTACACGGTGATCGAGGTCGAGGACGGCTTCCCCGTCGAAGAACCG
GAGGGATACCGATGGTTGACGGTCCATCAGGTGACCGGGCTGCTGCGGCACAGTCACTAT
CTCAACGTCCAGGCGCGCAGCCTCGTCGCATGTCTGCACAGTCTGTGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005212 NDP-hexose 2,3-dehydratase (Domain)
 [31-234]  5.20000000000001e-88 PF03559 [267-472]  2.59999999999995e-80 PF03559
PF03559   Hexose_dehydrat
SignalP
 [1-9]  0.12 Signal
Bacteria, Gram-negative   
TMHMM No significant hit