close all open/close all

CDS information : Polk_00150


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction18,424 / 16,769 / - [in whole cluster]
18,424 / 16,769 / - [in contig]
Locationcomplement(16769..18424) [in whole cluster]
complement(16769..18424) [in contig]
TypeCDS
Length1,656 bp (551 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative 6-methylsalicylic acid--CoA ligase
putative 6-methylsalicylyl-CoA synthetase
Product (GenBank)PokM3
Gene
Gene (GenBank)pokM3
EC number
Keyword
  • 3,6-dimethylsalicylic acid
Note
Note (GenBank)
  • putative 6-methylsalicylic acid-AMP ligase
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)
Related Reference
ACC
B0BLM7
NITE
Madu_00180
PmId
[20718468] Enediyne antitumor antibiotic maduropeptin biosynthesis featuring a C-methyltransferase that acts on a CoA-tethered aromatic substrate. (J Am Chem Soc. , 2010)
ACC
Q7X279
PmId
[15006746] Novel pathway of salicylate degradation by Streptomyces sp. strain WA46. (Appl Environ Microbiol. , 2004)

close this sectionSequence

selected fasta
>putative 6-methylsalicylic acid--CoA ligase [PokM3]
MKREGFVPWPADAARRYVEADCWRGRPLGALMWDWADAWADRTALVDGDVRLGYAELAAS
ADALAERLAGQGLADGDTVLVQLPNCWEFVVVTLACFRLGVAPVMMLPPHREYELASIGA
HVRAKALVVPGTWRGYDHQALAHRVAERLPDEPLVLVVGDDVRPGGVDVRALLRPDGDTA
ARRGRLDKAAPDAMEVALFLLSGGTTGLPKVISRTHNDYEYNIRQSAAACAVTAETVYLT
VLPAGHNYPLASPGILGTLSAGGRVVLLSSPRPDAVFAAIEREGVTTTSAVPAVALKWTE
AAPGCGRDLSSLRHVHVGGSVLSPELAARIGPALGCRVQQVYGMAEGLICYTAPDATDEV
AHGTQGAPVSAYDELLVVGPDGRPVRPGETGELLTRGPYTPRGYYGVPDQNALSFTPDGW
YRTGDLVRITAQGHVVVCGRVKDLINRGGEKIAAGEIETLVQEMPEVAEVAAVPAPDPEV
GERVCLFVRLHEGRALTLEDVSAALSGRGLAAFKIPERLEILPDLPHTPVGKPDKKALRG
LLDGTRVEVTP
selected fasta
>putative 6-methylsalicylic acid--CoA ligase [PokM3]
GTGAAACGCGAAGGGTTCGTGCCCTGGCCCGCAGACGCGGCGCGTCGTTACGTCGAGGCG
GACTGCTGGCGCGGCCGCCCGCTGGGCGCACTGATGTGGGACTGGGCGGACGCCTGGGCC
GACCGGACCGCGCTGGTCGACGGCGACGTCCGGCTCGGCTACGCGGAGCTGGCCGCCTCG
GCGGACGCCCTGGCCGAGCGGCTCGCGGGCCAAGGGCTGGCCGACGGCGACACGGTTCTC
GTGCAGTTGCCGAACTGCTGGGAGTTCGTCGTCGTGACGCTGGCCTGTTTCCGGCTCGGT
GTGGCGCCGGTGATGATGCTGCCGCCGCACCGCGAGTACGAACTGGCCTCGATCGGGGCC
CATGTGCGCGCCAAGGCGCTCGTCGTGCCCGGCACCTGGCGGGGCTACGACCATCAGGCC
CTCGCCCACCGGGTCGCCGAACGGCTGCCCGACGAGCCCTTGGTGCTGGTCGTCGGCGAC
GACGTACGGCCCGGCGGCGTCGACGTGCGCGCCCTGCTGAGGCCGGACGGCGACACGGCC
GCGCGGCGCGGGAGGCTGGACAAGGCCGCCCCCGACGCCATGGAGGTGGCCCTGTTCCTG
CTGTCCGGCGGCACCACCGGCCTGCCGAAGGTGATCAGCCGGACGCACAACGACTACGAG
TACAACATCCGGCAGTCCGCCGCCGCGTGTGCCGTCACCGCGGAGACCGTCTACCTGACG
GTCCTGCCCGCCGGCCACAACTACCCGCTCGCCAGCCCGGGCATCCTCGGCACCCTCTCG
GCCGGCGGCCGCGTCGTGCTGCTGTCCTCGCCGCGGCCCGACGCGGTGTTCGCCGCCATC
GAACGGGAGGGCGTCACGACCACCTCGGCGGTGCCCGCGGTGGCCCTGAAGTGGACGGAG
GCCGCGCCCGGTTGCGGACGCGACCTGTCGAGTCTGCGCCATGTGCACGTGGGCGGTTCG
GTGCTCTCACCCGAGCTCGCCGCCCGGATCGGGCCCGCCCTGGGCTGCCGGGTCCAGCAG
GTGTACGGGATGGCCGAGGGCCTCATCTGCTACACGGCTCCCGACGCGACGGACGAGGTC
GCCCACGGCACGCAGGGCGCCCCCGTCAGCGCGTACGACGAACTGCTGGTCGTCGGCCCG
GACGGCCGTCCGGTGCGGCCCGGCGAGACGGGCGAACTCCTCACCCGCGGCCCCTACACG
CCCCGTGGCTACTACGGCGTGCCCGACCAGAACGCCCTGTCGTTCACGCCCGACGGCTGG
TACCGCACGGGTGACCTGGTGCGGATCACCGCGCAGGGCCATGTGGTGGTGTGCGGCCGG
GTCAAGGACCTGATCAACCGCGGGGGCGAGAAGATCGCGGCCGGGGAGATAGAGACCCTG
GTGCAGGAGATGCCCGAGGTCGCCGAGGTGGCCGCGGTCCCGGCGCCGGACCCCGAAGTC
GGCGAGCGGGTCTGCCTGTTCGTCCGTCTCCACGAGGGTCGCGCGCTCACCCTGGAGGAC
GTGTCGGCGGCGCTGAGCGGGCGAGGGCTGGCCGCGTTCAAGATTCCCGAGCGCCTGGAG
ATCCTGCCCGACCTCCCGCACACACCCGTCGGCAAGCCCGACAAGAAGGCGCTGCGGGGT
CTGCTGGACGGGACGAGGGTCGAGGTGACCCCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [54-471]  1.60000000000002e-88 PF00501
PF00501   AMP-binding
IPR020845 AMP-binding, conserved site (Conserved_site)
 [199-210]  PS00455
PS00455   AMP_BINDING
IPR025110 Domain of unknown function DUF4009 (Domain)
 [513-545]  5.7e-05 PF13193
PF13193   DUF4009
SignalP No significant hit
TMHMM No significant hit