close all open/close all

CDS information : Polk_00160


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction23,640 / 18,421 / - [in whole cluster]
23,640 / 18,421 / - [in contig]
Locationcomplement(18421..23640) [in whole cluster]
complement(18421..23640) [in contig]
TypeCDS
Length5,220 bp (1,739 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
putative 6-methylsalicylic acid synthase
Product (GenBank)PokM1
Gene
Gene (GenBank)pokM1
EC number2.3.1.165
Keyword
  • iterative
  • 3,6-dimethylsalicylic acid
Note
Note (GenBank)
  • putative 6-methylsalicylic acid synthase
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)
Related Reference
ACC
Q0R4P8
NITE
Chth_00060
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)
[16677607] Cloning and characterization of a bacterial iterative type I polyketide synthase gene encoding the 6-methylsalicyclic acid synthase. (Biochem Biophys Res Commun. , 2006)
[20534347] Insights into bacterial 6-methylsalicylic acid synthase and its engineering to orsellinic acid synthase for spirotetronate generation. (Chem Biol. , 2010)
[26833898] Insights into 6-Methylsalicylic Acid Bio-assembly by Using Chemical Probes. (Angew Chem Int Ed Engl. , 2016)
ACC
P87162
PmId
[20304931] Hidden function of catalytic domain in 6-methylsalicylic acid synthase for product release. (J Biol Chem. , 2010)
ACC
P22367
PmId
[26833898] Insights into 6-Methylsalicylic Acid Bio-assembly by Using Chemical Probes. (Angew Chem Int Ed Engl. , 2016)

close this sectionPKS/NRPS Module

B1 acetyl-CoA
malonyl-CoA
KS6..380
AT542..857
TH865..1011
KR1369..1562
ACP1645..1722

close this sectionSequence

selected fasta
>polyketide synthase [PokM1]
MMTAPEPVAVVGMACRFAGGIDSPKEFWSLLVEGRDAIGEVPEGRWEWYGTLDRENAAAL
DGVTRYGAFLDDIKGFDADFFDVTPREAALMDPQQRIVLELAWEALEHAGIPPRDLAGSD
AGVFMGVGSDDYGRRMLEDLPRIEAWTGIGGAYCGVANRVSYTLDLRGPSVAVDTACSSS
LVSVHMAVQSLRAGECPVALAGGVLVMASPGLSLVLDAAGATAPDGRCKSFDANGDGYGR
GEGGGVVVLKRLSDARRDGDRVLALIRGSAVHQDGRTSGIMAPNGEAQAHLMRRTYEHAG
LDPVTVGYVEAHGTGTRAGDPLEAGAMASVFGVNRPQDRPCLIGSVKPNIGHLEAGAGIA
GVIKTVLALQHAEIPPSLNFTEPNPAVPWATSGLRVVTEPTPWPASDGPRRAGVSGYGYG
GTIAHVVLEQAPDPEGPQALDEGPRAVRDAEPAVYPLSGASEAAVREYAGRLADRLDETP
ATDLAEVGHTLATRRTHLLHRAAVVAANGNQLVSRLREFTNSGGAPGVGTGAVLPSAGRG
LVWVFSGHGSQWTGMGRELLVEEPVFARVVEELEPVFLEEMGVSLTAALLDDAPQPVDVV
QPLIFAVQTALSALWRERGLRPDAVIGHSVGEIAAAVAAGMLTREQGARLVCRRSLLLRR
VAGRGAMAMVGLTAEEAARRLGGRRDVTVAITASPGSTVVSGDVPAVVEISERWRAEGVA
VRAVDSDVAFHSPHMDPLLDDLTAAAADLVPSPATLPVYSTALDDPRSGAPRDGGYWAAN
LGGRVRFAQGVAAAVEDGYRLFLEVSPHPVVEHSVGETLDHLGVEDAFVTHSLRRRRPER
ETLLAGLGQLYCHGADVDWSRSWPATAPAELPCVAWQRKPYWLEEPPPRSAAGDRHDVST
HTLLGGRTTFAGTTPAQAWRTHLDRGSRPYPGDHPVREVEIIPAAVLLNTFLNAAASGGT
LPDLTDVALRVPVSVSQPREVQVVSQDATLRLTSRIVGEPGDDRGLVTHTTAGVEPHGAL
GEASPVVAPDVLPTGRVVDRLAELGVAAMGFAWEITELRGGEGVLVARVAADPKSSEPPA
TWASVLDAALSTASVVFPGPPVLRMPAHIKRVALEGACPATARITVRLAGEDVVDVEIEG
PQGTLVGRLDGLRYGLLEGDVGTTTGPRRLVHRMRWRPMEQQDPGAHRTVVLVGDDRSLV
ERLSRRLVAEAVPHRIASDPDELREGELSDDHTVVVVPAPGRPQEPVGRASLRASWLLAR
TAQRLAPAPRPPRLWCVTQGVRESATEASLAHGPLWGLGRVIAGEHPDLWGGIVDLGSSP
RDVAGFVDLLGTTHGEDVVAVREGQPEVARLALLDGEPVRPATTCRPDGTYLVTGGLGAL
GLEVAHWLAERGARRLVLTGRRSLPPRDEWDDVTDPLVRSRVEAVRSLERLGSTVVTVAL
DLADADAAEKLLSPTALGLPPVRGVVHAAGVLDDRPLRALDEDSLRAVLRPKAEGAWVLH
QLFPPGSLDFLVLFSSCGQLLGLPGQSSYAAGNAFLDALAAHRGAAGDTGTVSFGWTSWR
GLGMSTSSEVIDAELAAHGTADISALEAFASWELADRYGLGYAAVLRTLPPEPGQRRLPL
LGEVPTDAPHDQEDDEAEAPWAGLAGEELRTFLTSEVSRQVAAETRLSASEVDPHRALAE
MGLDSVMTVRIRRGLERQFRMPLPATLFWDRPTVHAVADLLAQRVDTPDPDPADERSAR
selected fasta
>polyketide synthase [PokM1]
GTGATGACGGCGCCCGAACCCGTCGCCGTGGTGGGCATGGCGTGCCGGTTCGCCGGAGGG
ATCGATTCGCCGAAGGAGTTCTGGTCGCTGCTCGTCGAGGGGCGGGACGCGATCGGCGAA
GTACCCGAGGGCCGCTGGGAGTGGTACGGAACGCTCGACCGGGAGAACGCGGCGGCCCTG
GACGGCGTGACGCGCTACGGTGCGTTCCTCGACGACATCAAGGGATTCGACGCCGACTTC
TTCGATGTCACCCCGCGCGAGGCCGCGCTGATGGACCCGCAGCAGCGGATCGTCCTGGAG
CTGGCCTGGGAGGCGCTGGAGCACGCGGGCATCCCGCCGCGGGATCTCGCGGGCAGCGAC
GCCGGTGTGTTCATGGGCGTCGGTTCGGACGACTACGGGCGCCGGATGCTGGAGGACCTG
CCTCGTATCGAGGCGTGGACCGGCATCGGCGGCGCCTATTGCGGGGTCGCCAACCGGGTC
TCGTACACGCTGGACCTGCGCGGGCCCAGCGTCGCCGTCGACACGGCGTGCTCGTCGTCG
CTGGTGTCCGTCCACATGGCGGTGCAGAGCCTGCGGGCCGGCGAGTGCCCGGTGGCGCTG
GCGGGCGGTGTGCTCGTGATGGCGTCACCCGGTCTGTCGCTGGTGCTGGACGCGGCGGGC
GCGACGGCACCCGACGGGCGCTGCAAGTCCTTCGACGCGAACGGCGACGGCTACGGCCGC
GGTGAGGGCGGCGGGGTCGTCGTCCTCAAGCGGCTGTCGGACGCCCGGCGCGACGGGGAC
CGCGTCCTCGCCCTGATCCGGGGCAGCGCGGTCCACCAGGACGGCAGGACCAGCGGCATC
ATGGCGCCCAACGGCGAGGCGCAGGCCCATCTCATGCGCCGGACGTACGAGCACGCGGGG
CTCGACCCGGTCACCGTCGGCTACGTCGAGGCGCACGGGACGGGTACCCGCGCGGGCGAT
CCGCTGGAGGCCGGGGCGATGGCCTCGGTCTTCGGCGTGAACCGGCCGCAGGACCGGCCG
TGTCTGATCGGGTCCGTCAAACCCAACATCGGGCATCTGGAGGCGGGCGCGGGCATCGCC
GGTGTGATCAAGACGGTCCTCGCTCTCCAGCACGCCGAGATCCCGCCCAGTCTGAACTTC
ACCGAGCCCAACCCCGCCGTCCCGTGGGCGACTTCGGGCCTTCGGGTGGTCACCGAGCCG
ACGCCCTGGCCCGCGTCCGACGGTCCGCGGCGGGCCGGGGTCTCGGGCTACGGATACGGC
GGCACCATCGCGCACGTCGTCCTGGAGCAGGCACCGGACCCCGAGGGTCCGCAGGCCCTG
GACGAGGGACCGCGCGCCGTGCGGGACGCGGAGCCCGCCGTGTATCCGCTGTCGGGCGCG
AGCGAGGCCGCGGTGCGGGAGTACGCGGGCAGGCTCGCCGACCGGCTCGACGAGACCCCC
GCGACGGATCTCGCGGAGGTGGGCCACACACTGGCCACGCGGCGCACGCATCTGCTCCAC
CGGGCCGCCGTGGTGGCCGCGAACGGCAACCAACTCGTCTCCCGGCTGAGGGAGTTCACG
AACTCGGGTGGCGCGCCGGGTGTCGGCACCGGCGCGGTGCTGCCGTCGGCCGGGCGCGGT
CTGGTCTGGGTGTTCTCCGGGCACGGCTCGCAGTGGACCGGCATGGGACGTGAACTCCTC
GTCGAGGAACCGGTGTTCGCGCGGGTCGTGGAGGAGCTGGAGCCCGTCTTCCTGGAGGAG
ATGGGCGTCTCCCTCACCGCCGCCCTCCTGGACGACGCCCCGCAGCCCGTCGACGTGGTG
CAGCCGCTGATCTTCGCCGTGCAGACGGCGCTGAGCGCACTGTGGCGGGAGCGCGGGCTG
CGCCCCGACGCGGTCATCGGCCACTCGGTCGGTGAGATCGCCGCCGCGGTGGCCGCCGGG
ATGCTCACGCGGGAGCAGGGCGCCCGGCTGGTGTGCCGACGCTCCCTGCTGCTGCGCCGG
GTGGCCGGACGGGGAGCCATGGCCATGGTGGGTCTGACGGCCGAGGAGGCCGCACGCCGT
CTCGGCGGCCGCCGGGACGTGACCGTGGCGATCACCGCGTCGCCCGGCTCCACCGTCGTC
TCCGGGGACGTCCCCGCGGTCGTGGAGATCTCCGAGCGGTGGCGCGCCGAGGGGGTCGCG
GTGCGGGCCGTGGATTCGGACGTGGCGTTCCACAGCCCGCACATGGACCCGCTCCTCGAC
GACCTGACGGCCGCGGCGGCCGACCTGGTGCCGTCACCCGCCACGCTTCCCGTCTACAGC
ACGGCTCTGGACGACCCCCGCAGCGGCGCCCCGCGCGACGGCGGCTACTGGGCCGCCAAC
CTCGGCGGCCGGGTGCGGTTCGCGCAGGGTGTCGCGGCGGCCGTCGAGGACGGGTACCGG
CTCTTCCTGGAGGTGTCGCCGCATCCGGTGGTCGAGCACTCGGTCGGCGAGACGCTCGAC
CACCTGGGCGTCGAGGACGCCTTCGTCACCCACTCGCTGCGTCGCCGCCGGCCCGAGCGC
GAGACACTGCTGGCCGGTCTCGGACAGCTGTACTGCCACGGCGCCGACGTGGACTGGTCG
CGTTCCTGGCCGGCGACCGCCCCCGCCGAGCTGCCGTGCGTCGCCTGGCAGCGCAAGCCG
TACTGGCTGGAGGAGCCGCCGCCGCGCTCCGCCGCCGGCGACCGGCACGACGTCAGCACG
CACACCCTGCTCGGCGGACGGACCACGTTCGCGGGCACGACCCCGGCGCAGGCGTGGCGG
ACCCACCTCGACCGCGGCAGCAGGCCCTACCCGGGTGACCATCCGGTCCGCGAGGTGGAG
ATCATCCCGGCCGCCGTGCTGCTGAACACCTTCCTGAACGCCGCCGCCTCGGGAGGCACC
CTGCCGGATCTCACCGATGTGGCGCTGCGCGTGCCCGTGTCGGTGTCCCAGCCGCGTGAG
GTCCAGGTCGTCAGCCAGGACGCCACGCTCCGGCTCACCTCGCGCATCGTCGGGGAACCC
GGCGACGACAGGGGTCTGGTCACCCACACCACGGCCGGCGTCGAGCCGCACGGCGCTCTC
GGCGAGGCGAGCCCGGTCGTCGCACCGGACGTACTGCCCACCGGGCGTGTGGTGGACCGC
CTCGCGGAACTCGGCGTCGCCGCCATGGGCTTCGCCTGGGAGATCACCGAACTGCGCGGC
GGCGAGGGCGTCCTGGTGGCCCGGGTCGCCGCGGACCCCAAGTCCTCGGAGCCGCCGGCC
ACCTGGGCCTCGGTCCTGGACGCCGCGCTGTCCACCGCGTCCGTGGTGTTCCCGGGTCCG
CCGGTGCTGCGCATGCCCGCGCACATCAAACGGGTCGCGCTCGAAGGGGCGTGCCCGGCC
ACCGCCCGCATCACCGTGCGGCTGGCCGGCGAGGACGTCGTCGACGTGGAGATCGAGGGC
CCGCAGGGCACGCTGGTGGGCCGGCTCGACGGGCTGCGGTACGGACTGCTGGAGGGCGAC
GTCGGGACCACCACCGGTCCCCGCCGGCTCGTCCACCGCATGCGATGGCGCCCCATGGAA
CAGCAGGACCCCGGTGCGCATCGGACGGTGGTGCTCGTCGGCGACGACCGCTCCCTGGTG
GAGCGGTTGAGCCGCCGGCTGGTCGCCGAGGCGGTGCCGCACCGGATCGCGTCCGACCCG
GACGAGCTGCGCGAGGGTGAACTCTCCGACGACCACACCGTGGTGGTCGTGCCGGCTCCG
GGACGGCCTCAGGAACCGGTCGGCAGGGCGTCCCTGCGGGCGTCCTGGCTGCTCGCGCGG
ACGGCGCAGCGGCTGGCCCCGGCCCCGCGTCCGCCCCGGCTGTGGTGCGTCACGCAGGGA
GTGCGCGAGAGCGCGACCGAGGCCTCGCTCGCCCACGGTCCCCTGTGGGGGCTGGGCCGG
GTCATCGCCGGTGAGCATCCGGACCTGTGGGGCGGCATCGTGGACCTCGGGTCCTCGCCC
CGGGACGTCGCGGGGTTCGTGGACCTGCTCGGCACGACGCACGGCGAGGACGTCGTGGCG
GTGCGCGAGGGACAGCCCGAGGTGGCTCGGCTCGCCCTGCTGGACGGCGAGCCGGTCCGG
CCCGCGACCACCTGCCGCCCGGACGGCACGTATCTGGTCACCGGCGGACTCGGCGCCCTC
GGGCTGGAGGTCGCGCACTGGCTGGCCGAGCGGGGCGCACGCCGTCTCGTGCTGACCGGA
CGGCGGTCGCTGCCGCCACGGGACGAGTGGGACGACGTCACCGATCCGCTGGTCCGGAGC
CGGGTGGAAGCGGTCAGGTCCCTGGAGCGGCTGGGCAGCACCGTGGTCACGGTCGCGCTG
GACCTCGCGGACGCGGACGCCGCGGAGAAGCTCCTGTCGCCGACCGCGCTGGGGCTGCCG
CCCGTCCGAGGCGTCGTGCACGCCGCCGGCGTCCTGGACGACCGGCCGCTGCGCGCGCTC
GACGAGGACTCGCTGCGGGCGGTGCTGCGGCCGAAGGCCGAGGGTGCCTGGGTGCTGCAC
CAGCTGTTCCCGCCCGGCAGTCTCGACTTCCTGGTGCTGTTCTCGTCCTGCGGTCAACTG
CTGGGCCTGCCGGGGCAGTCCAGCTACGCGGCGGGCAACGCGTTCCTGGACGCGCTGGCG
GCGCACCGCGGGGCCGCCGGGGACACCGGCACCGTCAGCTTCGGCTGGACGTCGTGGCGG
GGGCTCGGCATGTCGACCTCGTCCGAGGTCATCGACGCCGAGCTGGCCGCGCACGGCACC
GCCGACATCAGTGCCCTGGAGGCCTTCGCCTCCTGGGAGCTGGCGGACCGCTACGGCCTC
GGCTACGCGGCCGTGTTGCGCACGCTGCCGCCGGAACCCGGTCAACGGCGGCTCCCGCTG
CTGGGCGAGGTGCCCACGGACGCGCCGCACGACCAGGAGGACGACGAGGCCGAGGCCCCG
TGGGCCGGCCTGGCGGGCGAGGAGCTGCGCACCTTCCTCACCTCCGAGGTGAGCCGACAG
GTCGCGGCCGAGACCCGGCTGTCGGCGTCCGAGGTGGATCCGCACCGGGCCCTGGCCGAG
ATGGGCCTCGACTCGGTGATGACCGTGCGGATCCGGCGCGGTCTCGAAAGGCAGTTCAGG
ATGCCGCTGCCCGCGACGCTCTTCTGGGACCGCCCCACCGTCCACGCGGTCGCCGATCTG
CTCGCGCAGCGCGTCGACACCCCCGATCCCGACCCGGCCGACGAGAGGAGCGCACGGTGA
[1] KS6..380
[1] AT542..857
[1] acetyl-CoA malonyl-CoA728..732
[1] TH865..1011
[1] KR1369..1562
[1] ACP1645..1722
[1] KS16..1140
[1] AT1624..2571
[1] acetyl-CoA malonyl-CoA2182..2196
[1] TH2593..3033
[1] KR4105..4686
[1] ACP4933..5166

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [539-661]  1.09999999999999e-62 G3DSA:3.40.366.10 [728-844]  1.09999999999999e-62 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1680-1695]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1645-1722]  PS50075
PS50075   ACP_DOMAIN
 [1661-1721]  6.70000000000001e-09 PF00550
PF00550   PP-binding
 [1646-1725]  1.59999889349252e-16 SSF47336
SSF47336   ACP_like
 [1652-1725]  9.7e-17 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR013968 Polyketide synthase, KR (Domain)
 [1369-1561]  1.9e-60 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [6-255]  6.90000000000007e-91 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [263-380]  1.2e-43 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [542-857]  1.9e-90 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [540-824]  1.20000117458134e-59 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [663-727]  1.49999977583352e-12 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [6-266]  8.90000000000015e-92 G3DSA:3.40.47.10 [267-433]  1.29999999999998e-64 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [2-433]  1.59998835313644e-98 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1369-1568]  2.90000000000001e-32 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [168-184]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [544-837]  1.39999277195148e-93 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1654-1725]  3.1999989904635e-22 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [8-433]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1369-1562]  2.9000035467798e-56 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit