close all open/close all

CDS information : Polk_00170


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction24,665 / 23,637 / - [in whole cluster]
24,665 / 23,637 / - [in contig]
Locationcomplement(23637..24665) [in whole cluster]
complement(23637..24665) [in contig]
TypeCDS
Length1,029 bp (342 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative 3,6-dimethylsalicylyltransferase
Product (GenBank)PokM2
Gene
Gene (GenBank)pokM2
EC number
Keyword
  • 3,6-dimethylsalicylic acid
Note
Note (GenBank)
  • putative beta-ketoacyl-ACP synthase
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)
Related Reference
ACC
Q0R4P5
NITE
Chth_00090
PmId
[19266533] Dissection of two acyl-transfer reactions centered on acyl-S-carrier protein intermediates for incorporating 5-chloro-6-methyl-O-methylsalicyclic acid into chlorothricin. (Chembiochem. , 2009)

close this sectionSequence

selected fasta
>putative 3,6-dimethylsalicylyltransferase [PokM2]
MQGQDLYVRSLGVHLPEPVSTAQAVAEGRLDAEDVADGELTGVRVAGDVPAPELAVRAAR
QLFERVGADPSVVDLILYASVWHQGPDGWGPQSYVQRHLGGEALAVELRHGCTGVFSGLQ
LAAGFLRGNPQSSDALLLGAENFGTPLIDRWRATGGGMLVGDGASALLLGKEPGFAKLLW
VDCVAVPELEAMHRSGEPMFPPGATIGRRLDFSERNQHFLKYEGEQMRPLLMKAHQDLYD
RWTAATGLGVEDVTFLSYMNTSRTTIEKRLLPLLGLPAERTTWEVGRDIGHLGVSDQLVA
LDRLLCDGRLKPGDHYLMYGLGPGMTVAGAMFEITEVPSWTR
selected fasta
>putative 3,6-dimethylsalicylyltransferase [PokM2]
GTGCAAGGACAAGACCTGTACGTGAGGTCCCTCGGGGTGCATCTGCCGGAGCCCGTGAGC
ACCGCGCAGGCGGTGGCCGAGGGCCGCCTGGATGCCGAGGACGTCGCCGACGGCGAGCTG
ACGGGCGTGCGGGTCGCCGGTGACGTGCCCGCCCCGGAGCTCGCGGTGCGCGCGGCCCGC
CAGCTGTTCGAACGGGTCGGAGCCGACCCGTCGGTCGTCGATCTGATCCTGTACGCGAGC
GTGTGGCACCAGGGCCCGGACGGCTGGGGCCCGCAGTCGTATGTGCAGCGCCACCTCGGG
GGCGAGGCACTCGCGGTCGAGCTGCGGCACGGCTGCACCGGGGTGTTCAGCGGTCTGCAG
CTCGCCGCCGGCTTCCTGCGCGGCAATCCGCAGTCGTCGGACGCGCTGCTGCTCGGCGCG
GAGAACTTCGGCACCCCGCTGATCGACCGCTGGCGGGCCACCGGCGGCGGCATGCTGGTC
GGCGACGGCGCGAGCGCGCTGCTGCTCGGCAAGGAACCCGGCTTCGCCAAGCTGCTGTGG
GTCGACTGCGTCGCCGTACCCGAACTGGAGGCGATGCACCGCAGCGGAGAGCCGATGTTC
CCGCCGGGTGCCACGATCGGGCGGCGGCTCGATTTCTCCGAACGCAACCAGCACTTCCTC
AAGTACGAGGGGGAGCAGATGCGGCCGCTCCTGATGAAGGCCCACCAGGACCTGTACGAC
CGGTGGACGGCGGCGACCGGCCTCGGTGTCGAGGACGTCACCTTCCTCAGCTACATGAAC
ACCTCGCGCACCACGATCGAGAAGCGGCTGCTTCCCCTGCTGGGGCTGCCCGCGGAGCGC
ACCACCTGGGAGGTGGGGCGCGACATCGGGCATCTCGGCGTCAGCGACCAGCTCGTCGCG
CTCGACCGGCTGCTGTGCGACGGCAGGCTGAAGCCGGGCGACCACTACCTGATGTACGGG
CTCGGGCCCGGTATGACGGTGGCGGGAGCGATGTTCGAGATCACCGAGGTGCCGTCGTGG
ACGCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013747 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C-terminal (Domain)
 [244-334]  1.4e-15 PF08541
PF08541   ACP_syn_III_C
IPR013751 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III (Domain)
 [108-172]  1.2e-09 PF08545
PF08545   ACP_syn_III
IPR016038 Thiolase-like, subgroup (Domain)
 [4-165]  5.90000000000001e-21 G3DSA:3.40.47.10 [166-174]  1e-21 G3DSA:3.40.47.10 [206-333]  1e-21 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [10-334]  4.09999599045784e-28 SSF53901
SSF53901   Thiolase-like
SignalP
 [1-24]  0.129 Signal
Bacteria, Gram-positive   
 [1-21]  0.105 Signal
Eukaryota   
TMHMM No significant hit