close all open/close all

CDS information : Polk_00180


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction25,763 / 24,720 / - [in whole cluster]
25,763 / 24,720 / - [in contig]
Locationcomplement(24720..25763) [in whole cluster]
complement(24720..25763) [in contig]
TypeCDS
Length1,044 bp (347 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Product6-methylsalicylyl-CoA C-3 C-methyltransferase
Product (GenBank)PokMT1
Gene
Gene (GenBank)pokMT1
EC number2.1.1.-
Keyword
  • 3,6-dimethylsalicylic acid
Note
Note (GenBank)
  • C-methyltransferase
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)
Related Reference
ACC
B0BLM5
NITE
Madu_00160
PmId
[20718468] Enediyne antitumor antibiotic maduropeptin biosynthesis featuring a C-methyltransferase that acts on a CoA-tethered aromatic substrate. (J Am Chem Soc. , 2010)

close this sectionSequence

selected fasta
>6-methylsalicylyl-CoA C-3 C-methyltransferase [PokMT1]
MASGTITVSEADYLRILIHGTTAFELLRTGLEFDLFERLEAAEGMDVEEVAEAIGTEAQP
ARILLLGLASLRLLEKKDNKYVNSEMVRRKLLRSSPRFLGPLVDIQADIINRSLGDFAES
MRQNTNVGLRHIEGPGDTLYERLTAHPELQEVFYRNMGDASKKAFAQILDRYDFSGLHHV
IDIGGGDGTNSIELARRYPHLEVTVFDQESVTRIAAQRTEDAELSKRVHFHPGDLFTDAL
PEGADGIMFFHIFEIWSLERNTELLRKCYEALPPGGVCLVYNFVSNDEGTGSMSGGLVSP
YFLTLASGEGMTYAPKDMDKAIRDAGFSRVERYDGLGFSHSLVVGHK
selected fasta
>6-methylsalicylyl-CoA C-3 C-methyltransferase [PokMT1]
ATGGCCAGCGGCACCATCACCGTCAGCGAAGCGGACTACCTGCGGATCCTCATTCACGGC
ACGACCGCGTTCGAACTGCTGCGCACGGGGCTTGAGTTCGACCTCTTCGAGCGCCTGGAG
GCGGCCGAGGGCATGGATGTCGAGGAGGTCGCGGAGGCGATCGGCACCGAGGCCCAGCCC
GCCCGCATCCTGCTCCTCGGGCTCGCCTCGCTGCGGCTTCTGGAGAAGAAGGACAACAAG
TACGTCAACAGCGAGATGGTGCGGCGCAAGCTGCTCAGGTCGAGCCCGCGCTTCCTGGGC
CCGCTGGTGGACATCCAGGCCGACATCATCAACCGCTCCCTCGGCGACTTCGCCGAGTCG
ATGCGGCAGAACACCAACGTGGGCCTGCGCCACATCGAGGGTCCCGGCGACACGCTGTAC
GAACGGCTCACGGCGCACCCCGAGTTGCAGGAGGTGTTCTACCGGAACATGGGCGACGCG
TCGAAGAAGGCGTTCGCGCAGATCCTCGACCGGTACGACTTCTCCGGGCTGCACCATGTC
ATCGACATCGGCGGCGGCGACGGCACCAACAGCATCGAACTGGCCCGCCGCTACCCGCAC
CTGGAGGTGACGGTCTTCGACCAGGAGAGCGTCACCCGCATCGCGGCGCAGCGGACCGAG
GACGCCGAGCTGAGCAAGCGGGTGCACTTCCACCCGGGCGACCTGTTCACCGACGCGCTG
CCCGAGGGCGCCGACGGGATCATGTTCTTCCACATCTTCGAGATCTGGTCGCTGGAGCGG
AACACCGAGCTGCTGCGCAAGTGCTACGAGGCCCTGCCGCCCGGCGGTGTCTGCCTGGTC
TACAACTTCGTCTCGAACGACGAGGGCACCGGCTCGATGAGCGGCGGGCTGGTCTCGCCC
TACTTCCTCACCCTCGCCTCCGGAGAGGGCATGACGTACGCCCCGAAGGACATGGACAAG
GCCATTCGCGACGCCGGCTTCTCCCGCGTCGAGCGCTACGACGGCCTCGGGTTCAGCCAC
TCCCTGGTCGTCGGCCACAAGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001077 O-methyltransferase, family 2 (Domain)
 [110-319]  1.99999999999999e-35 PF00891
PF00891   Methyltransf_2
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [13-85]  3.4e-11 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016461 O-methyltransferase, caffeic acid-type (Family)
 [1-347]  1.60000065022528e-08 PIRSF005739
PIRSF005739   O-mtase
SignalP
 [1-29]  0.106 Signal
Eukaryota   
TMHMM No significant hit