close all open/close all

CDS information : Polk_00190


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction25,972 / 27,240 / + [in whole cluster]
25,972 / 27,240 / + [in contig]
Location25972..27240 [in whole cluster]
25972..27240 [in contig]
TypeCDS
Length1,269 bp (422 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase beta-ketoacyl synthase subunit
Product (GenBank)PokP1
Gene
Gene (GenBank)pokP1
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
  • putative alpha-ketoacyl synthase
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)
Related Reference
ACC
Q54495
NITE
Nogl_00370
PmId
[8668120] A gene cluster involved in nogalamycin biosynthesis from Streptomyces nogalater: sequence analysis and complementation of early-block mutations in the anthracycline pathway. (Mol Gen Genet. , 1996)

close this sectionPKS/NRPS Module

A
KS3..374

close this sectionSequence

selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [PokP1]
MARDVVITGVGVVAPGGIGSKPFWDLLVSGRTATRTITHFDASPFRSTVAAECDFDAQAE
GLTAEEADRLDRATQFALVAAREALEDSGLAGDGPDPCRTGVTLGSAVGCTTSLEREYVV
TSHGGRDWLVDPDLAVPHLYDYFVPSSMAAEVAWAAGAQGPCSVVSTGCTSGLDAVGHAV
RLIEEGSADVMVAGGTDAPISPITVACFDAIRATTPRNDEPATASRPFDRTRNGFVLGEG
CAVFVLEERERARARGAHVYAGVGGFASRCNAFHMTGLRPDGKEMAAAIETALDEARVRP
DEVSYVNAHGSGTKQNDRHETAAFKKALGDHARRTPVSSIKSMIGHSLGAIGSVELAACA
LAIENGAVPPTANLYEPDPECDLDYVPLTAREARLDVVLSVGSGFGGFQSAMVLTRPGRA
EQ
selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [PokP1]
ATGGCCCGAGACGTAGTGATAACGGGTGTCGGCGTCGTCGCTCCAGGAGGCATCGGCAGC
AAACCGTTCTGGGACCTGCTCGTCTCCGGCCGCACCGCGACCCGCACCATCACCCACTTC
GACGCCTCGCCCTTTCGGTCGACCGTGGCCGCCGAGTGCGACTTCGACGCGCAGGCCGAA
GGGCTCACGGCCGAGGAGGCCGACCGGCTGGACCGGGCCACCCAGTTCGCGCTGGTCGCC
GCCCGCGAAGCACTGGAGGACAGCGGCCTCGCCGGCGACGGGCCGGACCCGTGCCGCACG
GGCGTCACGCTCGGCAGCGCGGTCGGCTGCACCACGAGCCTGGAACGCGAGTACGTCGTC
ACCAGTCACGGCGGCCGCGACTGGCTCGTCGACCCGGACCTCGCGGTCCCGCACCTCTAC
GACTACTTCGTCCCCAGCTCCATGGCCGCCGAGGTGGCCTGGGCCGCCGGCGCGCAGGGC
CCCTGCTCCGTGGTCTCCACGGGCTGCACCTCCGGGCTCGACGCGGTCGGCCACGCCGTA
CGGCTCATCGAGGAGGGCTCGGCGGACGTCATGGTCGCGGGCGGTACCGACGCGCCCATC
TCGCCCATCACGGTCGCCTGTTTCGACGCGATCCGGGCGACCACGCCCCGCAACGACGAA
CCGGCCACCGCCTCCCGCCCGTTCGACCGCACCCGCAACGGCTTCGTCCTGGGCGAGGGC
TGCGCCGTGTTCGTCCTGGAGGAACGGGAGCGGGCCAGGGCCCGCGGTGCCCATGTGTAC
GCCGGTGTCGGCGGGTTCGCCTCGCGGTGCAACGCCTTCCACATGACCGGACTGCGCCCG
GACGGCAAGGAGATGGCCGCCGCCATCGAGACGGCCCTGGACGAGGCCCGGGTGCGCCCG
GACGAAGTGAGCTACGTCAACGCACACGGCTCCGGCACCAAACAGAACGACCGGCACGAG
ACGGCCGCGTTCAAGAAGGCGCTGGGCGACCACGCCCGCCGTACGCCCGTCAGCTCCATC
AAGTCGATGATCGGCCACTCGCTCGGCGCCATCGGATCCGTCGAACTCGCGGCCTGCGCG
CTCGCCATCGAGAACGGCGCCGTCCCGCCGACGGCCAACCTGTACGAGCCGGACCCGGAA
TGCGACCTCGACTACGTGCCGTTGACGGCACGCGAGGCCCGGCTCGACGTCGTCCTCAGC
GTCGGCAGCGGATTCGGCGGCTTCCAGAGCGCGATGGTGCTCACCCGTCCCGGTCGGGCG
GAACAGTGA
KS3..374
KS7..1122

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [3-252]  2.1e-64 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [260-374]  7.20000000000003e-38 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [7-263]  9.9e-65 G3DSA:3.40.47.10 [270-416]  1.80000000000002e-53 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [2-257]  4.99996518094122e-69 SSF53901 [219-417]  6.59996953923913e-65 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [160-176]  PS00606
PS00606   B_KETOACYL_SYNTHASE
SignalP
 [1-34]  0.114 Signal
Eukaryota   
TMHMM No significant hit