close all open/close all

CDS information : Polk_00200


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction27,237 / 28,460 / + [in whole cluster]
27,237 / 28,460 / + [in contig]
Location27237..28460 [in whole cluster]
27237..28460 [in contig]
TypeCDS
Length1,224 bp (407 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase chain length factor subunit
Product (GenBank)PokP2
Gene
Gene (GenBank)pokP2
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
  • putative beta-ketoacyl synthase
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)
Related Reference
ACC
Q54496
NITE
Nogl_00380
PmId
[8668120] A gene cluster involved in nogalamycin biosynthesis from Streptomyces nogalater: sequence analysis and complementation of early-block mutations in the anthracycline pathway. (Mol Gen Genet. , 1996)

close this sectionPKS/NRPS Module

A
CLF2..364

close this sectionSequence

selected fasta
>polyketide synthase chain length factor subunit [PokP2]
MNAVVVTGLGVVAPNGLSTEEYWNATLAARSGIGRITRFEPERYPATLAGEIRGFEPAAH
LPGRLVPQTDHSTRLSLVAADEAVRDAGLDTGQLPEYGVGVVTANSAGGFEFGHQELDNL
WRKGPEYVSAYQSFAWFYAVNTGQISIRHGLRGSSGVLVADEAGGLDALAQARRLLRRDL
DAVLTGAVDGSLCPWGWIAQTSTGQLSTAEDPALAYRPFDERAAGFVPGEGGAILVVEDE
AKARARHAPRIHGRILGHAATFDPRPGTVPADDASALTRAVELALADAGAVPDDIDAVFA
DAAGVPHLDRAEAAALGAVFGARELPVAVPKTLTGRLCAGAGPLDVATALLALRDGVLPP
AAHTQPSPRYGLRVVVGRPLELRLRAVLVVARGLGGFNSAMVVGASH
selected fasta
>polyketide synthase chain length factor subunit [PokP2]
GTGAACGCTGTCGTCGTCACGGGCCTGGGCGTCGTCGCGCCGAACGGCCTGAGCACCGAG
GAGTACTGGAACGCCACTCTCGCGGCCCGCTCCGGCATCGGCCGCATCACCCGCTTCGAA
CCCGAGCGCTACCCCGCCACCCTGGCCGGCGAGATCCGCGGCTTCGAACCCGCCGCCCAT
CTGCCGGGCCGCCTCGTCCCGCAGACCGACCACTCCACCAGGCTCTCCCTGGTCGCCGCC
GACGAGGCCGTCCGCGACGCCGGCCTGGACACCGGACAACTGCCCGAGTACGGCGTGGGC
GTGGTGACCGCGAACAGCGCGGGCGGCTTCGAGTTCGGTCACCAGGAACTCGACAACCTG
TGGCGCAAGGGACCCGAGTACGTCAGCGCGTACCAGTCCTTCGCCTGGTTCTACGCGGTC
AACACCGGACAGATCTCCATCCGGCACGGCCTGCGCGGCTCCAGCGGGGTGCTGGTCGCC
GACGAGGCGGGCGGCCTCGACGCGCTCGCCCAGGCCAGGCGGCTGCTGCGCCGTGACCTG
GACGCCGTGCTCACCGGCGCGGTCGACGGCTCGCTGTGTCCCTGGGGCTGGATCGCCCAG
ACCTCGACCGGGCAGCTGAGCACGGCCGAGGACCCGGCTCTCGCGTACCGGCCGTTCGAC
GAGCGGGCCGCGGGCTTCGTGCCGGGAGAGGGCGGCGCCATCCTGGTCGTCGAGGACGAG
GCGAAGGCCCGCGCGCGGCACGCACCCCGGATCCACGGCAGGATCCTCGGACACGCCGCC
ACGTTCGACCCGAGACCGGGCACCGTGCCCGCGGACGACGCGTCCGCCCTGACCAGGGCC
GTCGAACTCGCCCTCGCCGACGCCGGTGCCGTGCCCGATGACATCGATGCCGTCTTCGCC
GACGCGGCCGGTGTCCCGCACCTGGACCGGGCGGAGGCCGCCGCGCTCGGCGCGGTCTTC
GGCGCGCGCGAGCTCCCGGTCGCCGTGCCCAAGACGCTGACCGGACGACTGTGTGCGGGC
GCAGGTCCCCTCGACGTCGCCACCGCGCTGCTCGCCCTGCGCGACGGGGTCCTTCCCCCT
GCGGCACACACCCAGCCGTCCCCCCGGTACGGGCTCCGTGTGGTCGTCGGCCGGCCGCTG
GAACTGCGCCTGCGTGCCGTGCTGGTCGTCGCCCGCGGCCTCGGCGGCTTCAACTCCGCG
ATGGTCGTGGGCGCCTCCCACTGA
CLF2..364
CLF4..1092

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [2-240]  3.99999999999998e-54 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [253-364]  1.6e-26 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [2-257]  2.29999999999998e-54 G3DSA:3.40.47.10 [267-404]  4.10000000000004e-34 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [1-248]  2.90000354677981e-61 SSF53901 [211-406]  3.10001307370206e-43 SSF53901
SSF53901   Thiolase-like
SignalP
 [1-19]  0.705 Signal
Eukaryota   
TMHMM No significant hit