close all open/close all

CDS information : Polk_00210


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction28,501 / 28,758 / + [in whole cluster]
28,501 / 28,758 / + [in contig]
Location28501..28758 [in whole cluster]
28501..28758 [in contig]
TypeCDS
Length258 bp (85 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase acyl carrier protein subunit
Product (GenBank)PokP3
Gene
Gene (GenBank)pokP3
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
  • acyl carrier protein
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)
Related Reference
ACC
Q9X463
NITE
Naphcy_00030
PmId
[10206788] Isolation and characterization of the naphthocyclinone gene cluster from Streptomyces arenae DSM 40737 and heterologous expression of the polyketide synthase genes. (Gene. , 1999)

close this sectionPKS/NRPS Module

A
ACP5..78

close this sectionSequence

selected fasta
>polyketide synthase acyl carrier protein subunit [PokP3]
MPELTMGELTRILRECAGEGEGVAHDGEFADTLFTDLGYDSLAVLETASRLKRDYGVELT
DDEVVDVGTPARLLELARRQIAARS
selected fasta
>polyketide synthase acyl carrier protein subunit [PokP3]
ATGCCAGAACTGACCATGGGAGAGCTCACCCGCATCCTGCGTGAGTGCGCGGGCGAGGGC
GAAGGCGTCGCCCACGACGGGGAGTTCGCGGACACGCTCTTCACCGACCTCGGCTACGAC
TCGCTGGCCGTACTGGAGACCGCGTCCCGCCTCAAACGGGACTACGGCGTCGAGCTGACC
GACGACGAGGTCGTCGACGTCGGCACCCCGGCCCGGCTCCTCGAACTGGCCAGGCGCCAG
ATCGCCGCGCGTTCATGA
ACP5..78
ACP13..234

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006162 Phosphopantetheine attachment site (PTM)
 [36-51]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [5-78]  PS50075
PS50075   ACP_DOMAIN
 [23-75]  4.5e-08 PF00550
PF00550   PP-binding
 [7-81]  1.5e-13 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1-84]  1.09999909120787e-14 SSF47336
SSF47336   ACP_like
SignalP
 [1-18]  0.089 Signal
Eukaryota   
TMHMM No significant hit