close all open/close all

CDS information : Polk_00230


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction30,499 / 31,035 / + [in whole cluster]
30,499 / 31,035 / + [in contig]
Location30499..31035 [in whole cluster]
30499..31035 [in contig]
TypeCDS
Length537 bp (178 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit
Product (GenBank)PokAC3
Gene
Gene (GenBank)pokAC3
EC number6.4.1.2
Keyword
Note
Note (GenBank)
  • putative biotin carboxylase carrier protein
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)
Related Reference
ACC
P0ABD8
PmId
[8631788] Purification and characterization of intact and truncated forms of the Escherichia coli biotin carboxyl carrier subunit of acetyl-CoA carboxylase. (J Biol Chem. , 1996)
[9398236] Structure of the carboxy-terminal fragment of the apo-biotin carboxyl carrier subunit of Escherichia coli acetyl-CoA carboxylase. (Biochemistry. , 1997)

close this sectionSequence

selected fasta
>putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit [PokAC3]
MPTPDSVATLDALLSDGRPDSLPSVLEAAKTSMIELFSEAPVPPSAVRVTVGPVTIEMDW
PGGTGAGTTAPQLAVPSQAGTAPVATPAASPTGQPPLDHIHAPTVGVFYRAPEPGAKPFV
TEGDTVVPGQQVGLIEAMKLMIPVESDRHGVIGEFLQPNAGLVEYGDPLCSLVPADGR
selected fasta
>putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit [PokAC3]
ATGCCCACGCCCGACAGCGTCGCCACCCTCGACGCCCTGCTGAGTGACGGACGCCCCGAC
AGTCTTCCCTCCGTCCTGGAGGCCGCCAAGACGAGCATGATCGAGCTCTTCTCGGAGGCT
CCCGTACCGCCGTCCGCCGTCCGCGTGACGGTCGGGCCGGTCACCATCGAGATGGACTGG
CCGGGCGGGACCGGCGCAGGCACCACGGCGCCGCAGCTCGCAGTTCCCTCGCAGGCAGGG
ACCGCACCGGTCGCGACGCCCGCGGCGTCGCCGACCGGACAGCCCCCGCTCGACCACATC
CACGCCCCGACGGTCGGGGTCTTCTACCGCGCGCCCGAACCGGGTGCCAAACCCTTCGTG
ACCGAGGGTGACACTGTCGTCCCCGGTCAACAGGTGGGCCTCATCGAGGCGATGAAGCTG
ATGATCCCCGTCGAGTCGGACCGGCACGGTGTCATCGGCGAGTTCCTCCAGCCCAACGCG
GGCCTCGTCGAGTACGGCGACCCGTTGTGCTCCCTCGTCCCGGCCGACGGGCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000089 Biotin/lipoyl attachment (Domain)
 [99-171]  1.3e-15 PF00364
PF00364   Biotin_lipoyl
 [98-172]  PS50968
PS50968   BIOTINYL_LIPOYL
IPR001249 Acetyl-CoA biotin carboxyl carrier (Family)
 [102-115]  1.49999977583352e-11 PR01071 [119-133]  1.49999977583352e-11 PR01071 [134-147]  1.49999977583352e-11 PR01071
PR01071   ACOABIOTINCC
IPR001882 Biotin-binding site (Binding_site)
 [129-146]  PS00188
PS00188   BIOTIN
IPR011053 Single hybrid motif (Domain)
 [94-172]  1.50000306971104e-17 SSF51230
SSF51230   Hybrid_motif
SignalP
 [1-28]  0.201 Signal
Bacteria, Gram-positive   
TMHMM No significant hit