close all open/close all

CDS information : Polk_00240


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction31,042 / 32,454 / + [in whole cluster]
31,042 / 32,454 / + [in contig]
Location31042..32454 [in whole cluster]
31042..32454 [in contig]
TypeCDS
Length1,413 bp (470 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative acetyl-CoA carboxylase biotin carboxylase subunit
Product (GenBank)PokAC2
Gene
Gene (GenBank)pokAC2
EC number6.4.1.2
6.3.4.14
Keyword
Note
Note (GenBank)
  • putative acetyl-CoA carboxylase alpha-subunit; biotin carboxylase
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)
Related Reference
ACC
P49787
PmId
[7592499] The genes encoding the biotin carboxyl carrier protein and biotin carboxylase subunits of Bacillus subtilis acetyl coenzyme A carboxylase, the first enzyme of fatty acid synthesis. (J Bacteriol. , 1995)

close this sectionSequence

selected fasta
>putative acetyl-CoA carboxylase biotin carboxylase subunit [PokAC2]
MFRTVLVANRGEIALRVARACRELGIRVAVVYSTEDTDSEVVRYADEAVRIGPGSAQASY
LSIPAVIEAARRVGADAIHPGYGFLSENADFAEVCAAEGITFIGPPPEVMEALGDKSTCR
GLMADAGLPLLPGTLDPVSSPREAEAFAAEIGYPVVVKAVAGGGGRGIGVAHSADEFPAV
YRETRRHAAAVFGDGRVYLERYLQSARHVEIQILADRFGNVIHLGERDCSVQRRHQKLIE
ETPAPGLDRDVLAAMAEHAVQGAKAAGYVGAGTFEFLYDDSGRFYFMEVNCRIQVEHPVT
EMVTGVDLVHEQLWVAAGHPLRLGRRDVVPRGCAVECRINAEDADRDFTPTPGLIDELTL
PAGPFVRVDTHVRDGSRISVFYDPLLAKVAVWAPDRELALARMRRALDEVRIEGKGMHTT
AGFLRSVVESDEFSTARHDTGLVGRLLEPEPAAAGTRDPGPSQAQPPNAS
selected fasta
>putative acetyl-CoA carboxylase biotin carboxylase subunit [PokAC2]
GTGTTCCGCACCGTCCTCGTCGCCAACCGGGGCGAGATCGCCCTGCGTGTCGCGCGCGCC
TGCCGTGAACTGGGGATCAGGGTCGCCGTCGTGTACTCCACCGAGGACACCGACAGCGAG
GTCGTGCGGTACGCCGACGAGGCGGTCCGCATCGGCCCGGGGTCGGCGCAGGCGAGCTAC
CTCAGCATCCCCGCCGTCATCGAGGCCGCCCGGCGCGTCGGCGCGGACGCGATCCACCCC
GGGTACGGATTCCTCTCCGAGAACGCCGACTTCGCCGAGGTGTGCGCGGCCGAGGGCATC
ACCTTCATCGGCCCGCCCCCGGAGGTGATGGAGGCGCTGGGCGACAAGTCCACCTGCCGC
GGCCTCATGGCCGACGCGGGGCTGCCCCTGCTGCCCGGCACGCTGGACCCCGTGTCGTCG
CCGCGCGAGGCCGAGGCGTTCGCCGCCGAGATCGGCTACCCGGTGGTGGTGAAGGCGGTG
GCCGGGGGCGGCGGCCGCGGGATCGGAGTGGCGCACTCGGCCGACGAGTTCCCCGCCGTC
TACCGGGAGACGCGACGCCACGCCGCCGCCGTGTTCGGGGACGGCAGGGTCTATCTGGAG
CGCTATCTGCAGTCCGCACGGCACGTGGAGATCCAGATACTCGCCGACCGCTTCGGCAAT
GTGATCCATCTCGGCGAGCGCGACTGCTCGGTGCAGCGCCGCCATCAGAAGCTCATCGAG
GAGACCCCGGCTCCCGGGCTGGACCGCGATGTGCTCGCCGCGATGGCGGAACACGCCGTG
CAGGGAGCCAAGGCCGCCGGATACGTCGGCGCGGGGACCTTCGAGTTCCTGTACGACGAC
AGCGGACGCTTCTACTTCATGGAGGTCAACTGCCGTATCCAGGTCGAGCATCCGGTCACA
GAAATGGTCACCGGCGTCGACCTGGTCCATGAGCAGCTGTGGGTCGCCGCCGGGCATCCG
CTGCGGCTCGGCCGGCGTGACGTCGTGCCCCGCGGGTGCGCCGTCGAGTGCCGTATCAAC
GCGGAGGACGCCGACCGGGACTTCACCCCGACGCCCGGGCTCATCGACGAACTCACCCTG
CCGGCGGGCCCGTTCGTGCGCGTGGACACGCATGTGCGGGACGGCTCGCGCATCTCCGTC
TTCTACGATCCGCTGCTCGCCAAGGTCGCCGTCTGGGCCCCCGACCGGGAGCTCGCGCTG
GCCCGTATGCGCCGTGCCCTGGACGAGGTCCGGATCGAGGGCAAGGGCATGCACACCACG
GCGGGTTTCCTCCGCTCGGTCGTCGAGAGCGACGAGTTCAGCACGGCCCGGCACGACACC
GGGCTCGTCGGCCGGCTCCTGGAGCCCGAGCCGGCTGCCGCAGGGACCCGGGACCCGGGG
CCCTCGCAGGCGCAACCACCGAACGCCTCGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005479 Carbamoyl-phosphate synthetase large subunit-like, ATP-binding domain (Domain)
 [115-322]  5.20000000000001e-72 PF02786
PF02786   CPSase_L_D2
IPR005481 Carbamoyl-phosphate synthase, large subunit, N-terminal (Domain)
 [1-110]  6.00000000000001e-42 PF00289
PF00289   CPSase_L_chain
IPR005482 Biotin carboxylase, C-terminal (Domain)
 [336-444]  8.59998776239544e-54 SM00878
SM00878   Biotin_carb_C
 [336-443]  4.2e-35 PF02785
PF02785   Biotin_carb_C
IPR011054 Rudiment single hybrid motif (Domain)
 [331-449]  3.80000697093588e-40 SSF51246
SSF51246   Rudmnt_hyb_motif
IPR011761 ATP-grasp fold (Domain)
 [120-317]  PS50975
PS50975   ATP_GRASP
IPR011764 Biotin carboxylation domain (Domain)
 [1-448]  PS50979
PS50979   BC
IPR013815 ATP-grasp fold, subdomain 1 (Domain)
 [130-202]  1.5e-25 G3DSA:3.30.1490.20
G3DSA:3.30.1490.20   ATP_grasp_subdomain_1
IPR013816 ATP-grasp fold, subdomain 2 (Domain)
 [204-445]  5.00000000000001e-95 G3DSA:3.30.470.20
G3DSA:3.30.470.20   ATP_grasp_subdomain_2
IPR016185 Pre-ATP-grasp fold (Domain)
 [1-113]  2.69998997787809e-48 SSF52440
SSF52440   PreATP-grasp-like
 [1-129]  2.99999999999998e-48 G3DSA:3.40.50.20
G3DSA:3.40.50.20   Pre-ATP_grasp
SignalP
 [1-20]  0.093 Signal
Bacteria, Gram-negative   
TMHMM No significant hit