close all open/close all

CDS information : Polk_00250


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction32,469 / 33,533 / + [in whole cluster]
32,469 / 33,533 / + [in contig]
Location32469..33533 [in whole cluster]
32469..33533 [in contig]
TypeCDS
Length1,065 bp (354 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glucose-1-phosphate thymidylyltransferase
putative dTDP-glucose synthase
Product (GenBank)PokS1
Gene
Gene (GenBank)pokS1
EC number2.7.7.24
Keyword
  • beta-D-amicetose
  • alpha-L-axenose
Note
Note (GenBank)
  • putative NDP-glucose synthase
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)
Related Reference
ACC
Q194R4
NITE
Mith_00060
PmId
[9150235] Cloning and insertional inactivation of Streptomyces argillaceus genes involved in the earliest steps of biosynthesis of the sugar moieties of the antitumor polyketide mithramycin. (J Bacteriol. , 1997)

close this sectionSequence

selected fasta
>putative glucose-1-phosphate thymidylyltransferase [PokS1]
MKALVLSGGSGTRLRPITHTLAKQLVPVGNKPVLFHGLEAIAAAGVTETGIVVGDTRAQI
EAAVGDGSRFGLEVSYLWQRQPLGLAHAVKIARDFLGDDDFVMYLGDNIVFDGITDFVER
FRVHRPAAQIMLAQVDDPRQFGVAEVSAEGRVTGLQEKPRRPRSDLAVVGVYLFSSAVHK
AVAEVEPSARGELEITDAVQWLIDHDLRTDAAVMTGCWKDTGNVPDMLEVNRLVLRSLDP
SSAGIVRDSEISGQVVVEPGARVTGSVVVGPAVIGSGATVTNSRVGPYTSIAEDCRITDS
WIRDSIVMPRASITGVRPLESSLIGQDVEIARTPEPPGAHNLVLGDRSRVRIAS
selected fasta
>putative glucose-1-phosphate thymidylyltransferase [PokS1]
ATGAAAGCGCTCGTGCTTTCCGGCGGTTCAGGAACCCGGCTGCGGCCGATCACCCACACG
CTGGCCAAACAACTCGTGCCCGTGGGCAACAAACCGGTGCTGTTCCACGGCCTGGAAGCG
ATCGCCGCCGCGGGGGTGACGGAGACCGGCATCGTCGTCGGGGACACCCGTGCCCAGATC
GAGGCCGCGGTCGGCGACGGATCGCGGTTCGGCCTGGAGGTCTCCTATCTGTGGCAGCGG
CAGCCGCTCGGTCTGGCCCACGCTGTGAAGATAGCCCGTGACTTCCTCGGTGACGACGAC
TTCGTGATGTATCTGGGGGACAACATCGTCTTCGACGGCATCACCGACTTCGTGGAGCGG
TTCCGGGTCCATCGGCCGGCCGCGCAGATCATGCTCGCCCAGGTCGACGACCCCCGGCAG
TTCGGCGTGGCCGAGGTGTCCGCGGAGGGCCGCGTCACGGGGCTCCAGGAAAAACCGCGC
CGGCCGCGGAGCGATCTCGCCGTCGTGGGCGTCTATCTGTTCAGCTCGGCCGTGCACAAG
GCGGTCGCCGAGGTGGAGCCCTCGGCGCGCGGCGAACTGGAGATCACGGATGCGGTGCAG
TGGCTCATCGACCACGACCTGCGGACCGACGCCGCCGTCATGACCGGCTGCTGGAAGGAC
ACGGGAAACGTGCCGGACATGCTGGAGGTCAACCGGCTGGTGCTGCGATCCCTCGATCCC
TCCAGCGCCGGGATCGTGCGCGACAGTGAGATCAGCGGCCAGGTGGTCGTCGAGCCGGGG
GCGCGGGTGACCGGTTCCGTGGTCGTCGGCCCGGCCGTGATCGGCTCGGGAGCGACCGTC
ACCAACTCGCGTGTCGGCCCGTACACCTCGATCGCGGAGGACTGCCGTATCACCGACAGC
TGGATCCGCGACTCGATCGTGATGCCCCGTGCCTCGATCACCGGTGTCCGGCCGCTGGAG
TCCTCCCTGATCGGTCAGGACGTCGAGATCGCCCGCACCCCCGAACCGCCGGGTGCACAC
AACCTCGTCCTCGGGGACCGCAGCCGGGTGCGGATCGCGTCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005835 Nucleotidyl transferase (Domain)
 [2-234]  2.4e-58 PF00483
PF00483   NTP_transferase
IPR005908 Glucose-1-phosphate thymidylyltransferase, long form (Family)
 [2-351]  6.10000000000004e-127 TIGR01208
TIGR01208   RmlA_long
SignalP No significant hit
TMHMM No significant hit