close all open/close all

CDS information : Polk_00260


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction33,530 / 34,519 / + [in whole cluster]
33,530 / 34,519 / + [in contig]
Location33530..34519 [in whole cluster]
33530..34519 [in contig]
TypeCDS
Length990 bp (329 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative dTDP-glucose 4,6-dehydratase
Product (GenBank)PokS2
Gene
Gene (GenBank)pokS2
EC number4.2.1.46
Keyword
  • beta-D-amicetose
  • alpha-L-axenose
Note
Note (GenBank)
  • putative NDP-glucose 4,6-dehydratase
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)
Related Reference
ACC
Q54116
PmId
[7883182] Cloning of the genes encoding thymidine diphosphoglucose 4,6-dehydratase and thymidine diphospho-4-keto-6-deoxyglucose 3,5-epimerase from the erythromycin-producing Saccharopolyspora erythraea. (Gene. , 1995)

close this sectionSequence

selected fasta
>putative dTDP-glucose 4,6-dehydratase [PokS2]
MSGPRILVTGGAGFIGSHYVRAVLAGEYPAFADAEVTVLDKLTYAGNPANLGEVRCEFVW
GDLCDPELLSKVIPGQDVVVNFAAESHVDRSIAGSAEFVRTNVLGVHALLQACLEAGTPR
VVQVSTDEVYGSIDAGSWDEEAPLRPRSPYAASKAGGDLVARAYAVTHGLPVSITRCGNN
YGPRQYPEKVIPLFITRLLEGRKVPLYGDGGNVRDWVHVEDHCRGVQLVAERGEPGEIYH
IAGTAELTNRQLTERLLEACGRDWDMVEHVTDRKGHDRRYSLDDGKLRALGFAPRIPFAT
GLAETVRWYADHPEWRIGQSFVSREGDQS
selected fasta
>putative dTDP-glucose 4,6-dehydratase [PokS2]
ATGAGCGGACCGCGCATTCTGGTCACCGGCGGCGCCGGTTTCATCGGCTCCCACTACGTG
CGTGCCGTGCTGGCCGGGGAGTATCCCGCTTTTGCGGACGCGGAGGTGACAGTCCTCGAC
AAACTGACCTACGCCGGAAATCCCGCCAATTTGGGCGAAGTACGGTGCGAGTTCGTGTGG
GGCGATTTATGTGATCCTGAGCTGCTGAGCAAGGTGATACCCGGCCAAGATGTCGTCGTC
AATTTTGCCGCGGAATCCCACGTGGACCGCTCCATCGCCGGTTCCGCGGAATTCGTGCGG
ACCAATGTGCTCGGGGTCCACGCCCTGCTCCAGGCCTGTCTGGAGGCGGGAACGCCCCGT
GTCGTACAGGTCTCGACGGACGAGGTGTACGGGTCGATCGACGCCGGCTCGTGGGACGAG
GAGGCCCCGCTGCGGCCGCGTTCGCCCTATGCGGCGTCCAAGGCCGGCGGAGACCTGGTG
GCCCGTGCCTACGCGGTCACCCACGGCCTGCCGGTGTCCATCACCCGCTGCGGAAACAAC
TACGGACCGCGCCAGTACCCCGAGAAGGTCATTCCGCTCTTCATCACCAGGCTGCTGGAG
GGCCGGAAGGTGCCGCTGTACGGCGACGGTGGCAACGTCCGGGACTGGGTGCACGTCGAG
GACCACTGCCGTGGCGTGCAGCTCGTCGCGGAGCGCGGCGAGCCGGGCGAGATCTACCAC
ATCGCGGGCACCGCGGAATTGACCAATCGTCAATTGACCGAGCGTCTTCTCGAAGCCTGC
GGTCGTGACTGGGACATGGTGGAACACGTCACGGACCGCAAGGGACACGACCGGCGCTAC
AGCCTCGACGACGGCAAGCTGCGCGCTCTCGGTTTTGCTCCACGCATACCTTTCGCCACG
GGACTGGCCGAGACTGTTCGCTGGTACGCGGATCACCCAGAGTGGCGTATAGGGCAGAGC
TTTGTTTCACGAGAGGGGGATCAGTCGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [6-242]  1.40000000000001e-64 PF01370
PF01370   Epimerase
IPR005888 dTDP-glucose 4,6-dehydratase (Family)
 [5-315]  1.60000000000002e-116 TIGR01181
TIGR01181   DTDP_gluc_dehyt
IPR016040 NAD(P)-binding domain (Domain)
 [3-189]  2.59999999999998e-60 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-22]  0.847 Signal
Bacteria, Gram-negative   
 [1-25]  0.903 Signal
Eukaryota   
TMHMM No significant hit