close all open/close all

CDS information : Polk_00270


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction34,713 / 35,525 / + [in whole cluster]
34,713 / 35,525 / + [in contig]
Location34713..35525 [in whole cluster]
34713..35525 [in contig]
TypeCDS
Length813 bp (270 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator
Product (GenBank)PokR2
Gene
Gene (GenBank)pokR2
EC number
Keyword
  • SARP family
Note
Note (GenBank)
  • putative regulator of the SARP family
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)
Related Reference
ACC
Q83X33
PmId
[20378964] Regulation of lankamycin biosynthesis in Streptomyces rochei by two SARP genes, srrY and srrZ. (Biosci Biotechnol Biochem. , 2010)
ACC
Q83X29
PmId
[12791134] The large linear plasmid pSLA2-L of Streptomyces rochei has an unusually condensed gene organization for secondary metabolism. (Mol Microbiol. , 2003)
[20378964] Regulation of lankamycin biosynthesis in Streptomyces rochei by two SARP genes, srrY and srrZ. (Biosci Biotechnol Biochem. , 2010)

close this sectionSequence

selected fasta
>putative transcriptional regulator [PokR2]
MKLGVLGTLTIDDVEVAEILTAPKPRSVLAMLMLEPGRAVSTASLIQELWDERPPRSAST
TLQTYVLQLRRMFRDVAQVVGQPPTDALVTRVPGYLLQADHTEHDLSAYENLVEQGQKFL
EQGDNERAEELLSRALELWRGAPLSDVRPGPLLYPQICGLEESRLAATEMRIEANLRLGR
HREVQSELTVLVGSYPLHEGIRVKHMLALFRAGRLSAALDSFHQYRHRLVTDLGLEPSPR
IRGLQHAMLCFDPMADSLAILDRVASGVSH
selected fasta
>putative transcriptional regulator [PokR2]
ATGAAGCTCGGAGTGCTCGGTACATTAACCATCGATGATGTCGAAGTAGCCGAAATCCTG
ACGGCGCCCAAGCCTCGCAGCGTACTGGCGATGCTGATGCTCGAACCCGGCCGCGCGGTG
TCCACGGCCTCCCTGATCCAGGAGCTCTGGGACGAGCGCCCGCCGCGCAGCGCGTCCACG
ACGCTCCAGACGTACGTCCTGCAACTGCGGAGGATGTTCCGCGACGTCGCACAGGTGGTG
GGCCAGCCTCCGACGGACGCGCTCGTCACCCGGGTACCCGGGTACCTCCTCCAGGCGGAC
CACACCGAACACGACCTCAGCGCCTACGAGAACCTGGTCGAGCAGGGACAGAAGTTCCTG
GAGCAGGGCGACAACGAAAGAGCCGAAGAGCTGCTGTCCCGAGCGCTCGAACTCTGGCGC
GGCGCCCCGCTGAGCGACGTACGCCCCGGCCCGCTGCTCTATCCGCAGATCTGCGGCCTG
GAGGAGAGCCGGCTGGCCGCGACCGAGATGCGCATCGAGGCCAACCTGCGGCTCGGCCGG
CACCGCGAGGTACAGAGCGAACTGACCGTCCTGGTGGGCAGTTACCCCCTGCACGAGGGT
ATCCGCGTCAAGCACATGCTGGCCCTGTTCCGGGCCGGCCGGCTGTCCGCCGCGCTCGAC
TCGTTCCACCAGTACCGGCACCGGCTGGTGACCGACCTGGGCCTGGAACCGTCCCCACGC
ATACGGGGCCTCCAGCACGCCATGCTGTGCTTCGACCCCATGGCCGACTCGCTGGCGATA
CTCGACCGTGTGGCATCGGGCGTTTCCCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [19-97]  3.4e-16 PF00486
PF00486   Trans_reg_C
 [16-97]  7.19999557654549e-10 SM00862
SM00862   Trans_reg_C
IPR005158 Bacterial transcriptional activator domain (Domain)
 [104-249]  1.10000150671643e-40 SM01043
SM01043   BTAD
 [105-249]  4.39999999999996e-43 PF03704
PF03704   BTAD
IPR011990 Tetratricopeptide-like helical (Domain)
 [107-224]  8.1e-06 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [20-78]  1.2e-08 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [1-98]  4.70000326671386e-13 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit