close all open/close all

CDS information : Polk_00280


close this sectionLocation

Organism
StrainTü6028
Entry namePolyketomycin
Contig
Start / Stop / Direction36,714 / 35,677 / - [in whole cluster]
36,714 / 35,677 / - [in contig]
Locationcomplement(35677..36714) [in whole cluster]
complement(35677..36714) [in contig]
TypeCDS
Length1,038 bp (345 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
ProductC-6 C-methyltransferase
Product (GenBank)PokMT2
Gene
Gene (GenBank)pokMT2
EC number2.1.1.-
Keyword
Note
Note (GenBank)
  • C-methyltransferase
Reference
ACC
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)

close this sectionSequence

selected fasta
>C-6 C-methyltransferase [PokMT2]
MTAPALEAVTNLRRLALAAGHAAALRAAVQLGVADALGEDPATAAELARLVNAEPGTLDR
LLRALSSQGVFLAQGDRYAHTPVSRLLRGDTPRSLRDMVLWATEPWTWEVWPRLADAVRT
GKGGFGETHGKDFFTYLYEDAPESAEVFNRAMTQASRLSSGAIAETLDLRGDLTVVDVAG
GHGDLIATVLERDPSLRGALFDLPGVLEDVDARLRKGGALEGRCRLVAGDCRESVQVEAD
VFILKNVLEWDDAATVAALRNVAASARPGGRVVVIENLVDGSPETGFTTAMDLLLLLNVD
GRKHLRRSLLRLVEEAGLTVTDVRPVGPYLHMIDSRVPEGGDTGR
selected fasta
>C-6 C-methyltransferase [PokMT2]
ATGACAGCTCCCGCTCTCGAAGCCGTGACGAACCTCCGCAGACTCGCCCTGGCCGCAGGT
CACGCGGCCGCGCTCCGCGCCGCGGTACAGCTCGGCGTGGCCGACGCGCTCGGTGAGGAC
CCCGCGACCGCCGCCGAGCTGGCGCGCCTGGTGAACGCCGAACCGGGCACGCTCGACCGG
CTGTTGCGCGCGCTCAGCTCGCAGGGCGTGTTCCTCGCCCAGGGCGACCGCTACGCGCAC
ACGCCGGTCTCCCGACTGCTGCGCGGCGACACCCCGCGCAGCCTGCGCGACATGGTCCTG
TGGGCCACCGAACCGTGGACCTGGGAGGTCTGGCCGCGTCTCGCCGACGCCGTCCGTACA
GGAAAGGGCGGCTTCGGCGAGACGCACGGCAAGGACTTCTTCACCTATCTGTACGAGGAC
GCGCCGGAGTCGGCCGAGGTCTTCAACCGCGCCATGACGCAGGCCAGCCGGCTCTCGTCC
GGGGCGATCGCCGAGACGCTCGACCTGCGCGGCGACCTGACCGTGGTGGATGTAGCCGGC
GGCCACGGCGACCTCATCGCGACCGTCCTGGAGCGCGACCCGTCCCTGCGCGGTGCCCTG
TTCGACCTGCCCGGTGTGCTGGAGGACGTCGACGCGCGGCTGCGCAAGGGCGGTGCGCTG
GAGGGCCGTTGCCGTCTGGTGGCCGGTGACTGCCGGGAGTCGGTGCAGGTCGAGGCGGAC
GTCTTCATCCTGAAGAACGTCCTGGAGTGGGACGACGCGGCCACCGTGGCCGCGCTGCGC
AATGTCGCCGCCTCCGCCCGTCCGGGCGGACGGGTCGTCGTCATCGAGAACCTGGTCGAC
GGAAGCCCCGAGACCGGGTTCACCACTGCCATGGACCTGCTCCTGCTGCTCAACGTCGAC
GGCCGCAAGCACCTGCGCCGCAGTCTGCTGCGCCTGGTCGAGGAGGCCGGGTTGACGGTG
ACCGACGTCCGGCCGGTCGGCCCGTATCTGCACATGATCGACAGCCGGGTTCCCGAAGGC
GGGGACACCGGTCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001077 O-methyltransferase, family 2 (Domain)
 [76-304]  3.7e-44 PF00891
PF00891   Methyltransf_2
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [11-84]  3.8e-16 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR012967 Plant methyltransferase dimerisation (Domain)
 [24-65]  2.3e-05 PF08100
PF08100   Dimerisation
IPR016461 O-methyltransferase, caffeic acid-type (Family)
 [1-332]  4.19999771339581e-15 PIRSF005739
PIRSF005739   O-mtase
SignalP
 [1-27]  0.427 Signal
Bacteria, Gram-negative   
 [1-24]  0.396 Signal
Bacteria, Gram-positive   
 [1-34]  0.917 Signal
Eukaryota   
TMHMM No significant hit